Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone H1oo

Gene

H1foo

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May play a key role in the control of gene expression during oogenesis and early embryogenesis, presumably through the perturbation of chromatin structure. Essential for meiotic maturation of germinal vesicle-stage oocytes. The somatic type linker histone H1c is rapidly replaced by H1oo in a donor nucleus transplanted into an oocyte. The greater mobility of H1oo as compared to H1c may contribute to this rapid replacement and increased instability of the embryonic chromatin structure. The rapid replacement of H1c with H1oo may play an important role in nuclear remodeling.4 Publications

GO - Molecular functioni

  • DNA binding Source: MGI
  • double-stranded DNA binding Source: GO_Central
  • nucleosomal DNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processMeiosis

Names & Taxonomyi

Protein namesi
Recommended name:
Histone H1oo
Alternative name(s):
Oocyte-specific histone H1
Oocyte-specific linker histone H1
Gene namesi
Name:H1foo
Synonyms:H1oo
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2176207 H1foo

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003434131 – 304Histone H1ooAdd BLAST304

Proteomic databases

PaxDbiQ8VIK3
PRIDEiQ8VIK3

PTM databases

iPTMnetiQ8VIK3
PhosphoSitePlusiQ8VIK3

Expressioni

Tissue specificityi

Oocyte-specific.2 Publications

Developmental stagei

Expressed as early as the germinal vesicle (GV) stage oocyte, and persists into the metaphase II stage oocyte, the oocytic polar bodies, and the 2-cell embryo, and disappears at the 4-to 8-cell embryonic stage.1 Publication

Gene expression databases

BgeeiENSMUSG00000042279 Expressed in 71 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ8VIK3 baseline and differential
GenevisibleiQ8VIK3 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000036951

Structurei

3D structure databases

ProteinModelPortaliQ8VIK3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 123H15PROSITE-ProRule annotationAdd BLAST79

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi154 – 170Nuclear localization signalSequence analysisAdd BLAST17

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5 – 13Poly-Ser9

Sequence similaritiesi

Belongs to the histone H1/H5 family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4012 Eukaryota
ENOG4112541 LUCA
GeneTreeiENSGT00900000141023
HOGENOMiHOG000112841
HOVERGENiHBG096668
InParanoidiQ8VIK3
OMAiSANMAKM
OrthoDBiEOG091G0LIU
PhylomeDBiQ8VIK3
TreeFamiTF333386

Family and domain databases

CDDicd00073 H15, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR005818 Histone_H1/H5_H15
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00538 Linker_histone, 1 hit
SMARTiView protein in SMART
SM00526 H15, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
PROSITEiView protein in PROSITE
PS51504 H15, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8VIK3-1) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPGSVSSVS SSSFPSRDTS PSGSCGLPGA DKPGPSCRRI QAGQRNPTML
60 70 80 90 100
HMVLEALKAR EARQGTSVVA IKVYIQHKYP TVDTTRFKYL LKQALETGVR
110 120 130 140 150
RGLLTRPAHS KAKGATGSFK LVPKPKTKKA CAPKAGRGAA GAKETGSKKS
160 170 180 190 200
GLLKKDQVGK ATMEKGQKRR AYPCKAATLE MAPKKAKAKP KEVRKAPLKQ
210 220 230 240 250
DKAAGAPLTA NGGQKVKRSG SRQEANAHGK TKGEKSKPLA SKVQNSVASL
260 270 280 290 300
AKRKMADMAH TVTVVQGAET VQETKVPTPS QDIGHKVQPI PRVRKAKTPE

NTQA
Length:304
Mass (Da):32,223
Last modified:March 1, 2002 - v1
Checksum:i716400ADF8CA8FE4
GO
Isoform 2 (identifier: Q8VIK3-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     244-304: QNSVASLAKRKMADMAHTVTVVQGAETVQETKVPTPSQDIGHKVQPIPRVRKAKTPENTQA → GPE

Show »
Length:246
Mass (Da):25,919
Checksum:iA76B3DC10CAAC502
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E0CZ52E0CZ52_MOUSE
Histone H1oo
H1foo
251Annotation score:
E0CYL2E0CYL2_MOUSE
Histone H1oo
H1foo
46Annotation score:
A0A0N4SV54A0A0N4SV54_MOUSE
Histone H1oo
H1foo
64Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_034593244 – 304QNSVA…ENTQA → GPE in isoform 2. 1 PublicationAdd BLAST61

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY007195 mRNA Translation: AAG01890.1
AK135944 mRNA Translation: BAE22736.1
AK162137 mRNA Translation: BAE36747.1
CH466523 Genomic DNA Translation: EDK99547.1
BC137916 mRNA Translation: AAI37917.1
CCDSiCCDS20447.1 [Q8VIK3-1]
CCDS85133.1 [Q8VIK3-2]
RefSeqiNP_001333631.1, NM_001346702.1 [Q8VIK3-2]
NP_612184.1, NM_138311.3 [Q8VIK3-1]
UniGeneiMm.21899

Genome annotation databases

EnsembliENSMUST00000037831; ENSMUSP00000036951; ENSMUSG00000042279 [Q8VIK3-1]
ENSMUST00000161969; ENSMUSP00000123797; ENSMUSG00000042279 [Q8VIK3-2]
GeneIDi171506
KEGGimmu:171506
UCSCiuc009djl.1 mouse [Q8VIK3-1]
uc009djm.1 mouse [Q8VIK3-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY007195 mRNA Translation: AAG01890.1
AK135944 mRNA Translation: BAE22736.1
AK162137 mRNA Translation: BAE36747.1
CH466523 Genomic DNA Translation: EDK99547.1
BC137916 mRNA Translation: AAI37917.1
CCDSiCCDS20447.1 [Q8VIK3-1]
CCDS85133.1 [Q8VIK3-2]
RefSeqiNP_001333631.1, NM_001346702.1 [Q8VIK3-2]
NP_612184.1, NM_138311.3 [Q8VIK3-1]
UniGeneiMm.21899

3D structure databases

ProteinModelPortaliQ8VIK3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000036951

PTM databases

iPTMnetiQ8VIK3
PhosphoSitePlusiQ8VIK3

Proteomic databases

PaxDbiQ8VIK3
PRIDEiQ8VIK3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000037831; ENSMUSP00000036951; ENSMUSG00000042279 [Q8VIK3-1]
ENSMUST00000161969; ENSMUSP00000123797; ENSMUSG00000042279 [Q8VIK3-2]
GeneIDi171506
KEGGimmu:171506
UCSCiuc009djl.1 mouse [Q8VIK3-1]
uc009djm.1 mouse [Q8VIK3-2]

Organism-specific databases

CTDi132243
MGIiMGI:2176207 H1foo

Phylogenomic databases

eggNOGiKOG4012 Eukaryota
ENOG4112541 LUCA
GeneTreeiENSGT00900000141023
HOGENOMiHOG000112841
HOVERGENiHBG096668
InParanoidiQ8VIK3
OMAiSANMAKM
OrthoDBiEOG091G0LIU
PhylomeDBiQ8VIK3
TreeFamiTF333386

Miscellaneous databases

ChiTaRSiH1foo mouse
PROiPR:Q8VIK3
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000042279 Expressed in 71 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ8VIK3 baseline and differential
GenevisibleiQ8VIK3 MM

Family and domain databases

CDDicd00073 H15, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR005818 Histone_H1/H5_H15
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00538 Linker_histone, 1 hit
SMARTiView protein in SMART
SM00526 H15, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
PROSITEiView protein in PROSITE
PS51504 H15, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiH1FOO_MOUSE
AccessioniPrimary (citable) accession number: Q8VIK3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: March 1, 2002
Last modified: November 7, 2018
This is version 125 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again