Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 108 (13 Nov 2019)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Brain and acute leukemia cytoplasmic protein

Gene

Baalc

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a synaptic role at the postsynaptic lipid rafts possibly through interaction with CAMK2A.By similarity

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Brain and acute leukemia cytoplasmic protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Baalc
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1928704 Baalc

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane, Synapse, Synaptosome

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002482062 – 145Brain and acute leukemia cytoplasmic proteinAdd BLAST144

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineBy similarity1
Lipidationi3S-palmitoyl cysteineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylation and myristoylation target the protein to the lipid rafts.By similarity

Keywords - PTMi

Lipoprotein, Myristate, Palmitate

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8VHV1

PRoteomics IDEntifications database

More...
PRIDEi
Q8VHV1

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8VHV1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

At the mRNA level, predominantly expressed in the brain (PubMed:11707601). At the protein level, mainly expressed in muscle tissues. In skeletal muscles, expressed in cranial and facial muscles, muscles of the neck, back, thoracic wall, and thigh. Also found in the contractile myoepithelial cell layer of salivary glands. In smooth muscles, expressed in the gastric wall, uterus, urinary bladder, as well as in the muscular lining around seminiferous tubules, prostatic ducts, epididymis, vas deferens, walls of small blood vessels in the dermis, and fascial layers between muscle fibers, brain, and around the spinal cord. Strongly expressed in myocardium. High expression levels are observed in placental spongiotrophoblast and adjacent myometrium. Also expressed in bone marrow hematopoietic cells. In the mature thymus, expressed in rare scattered cells. Weakly expressed in the brain neuropil, particularly near the hippocampus, and spinal cord white matter. Not detected in skin keratinocytes or lung (at protein level) (PubMed:15749074).2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

During embryonic development, prominently expressed in muscle tissues, including myocardium, skeletal and smooth muscles, and weakly in the developing central nervous system (only in the neuropil). At 9 dpc, expressed in the wall and trabeculae of the developing heart tube, in the caudal end of the midline dorsal aorta, and a focal area of the mesenchyme around the developing brain. Weakly expressed in marginal and ependymal layers of the early neural tube. At 11-12.5 dpc, expression persists in the myocardium. Scattered signal in the mesoderm on either side of the developing neural tube. Also found in the region of dermatomyotomes. Appears to be associated with the early pre-muscle mesoderm and later with myoblasts and myocytes of the paravertebral, back, body wall and limb muscles. At 13-15 dpc, besides the myocardium, expression is seen in the skeletal muscles of the limbs, intercostal muscles, and the diaphragm, as well as in the developing muscle layer in the wall of the few intestinal coils present in the abdominal cavity. Also found in various components of the mesenchymal precartilage forming the framework of the cranium and the face, notably, the base of the skull, frontonasal process and parts of the primitive maxillary and mandibular processes. Around 13 dpc, detected in the brain lateral ventricles and the roof of the fourth ventricle. At 15 dpc, scattered groups of positive cells are observed in the liver, around the venous sinuses. Weakly expressed in the brain and spinal cord white matter. Prominent membrane expression in the choroid plexus and meninges. At 15-18 dpc, transiently expressed in the layers of ectodermal cells covering the embryo and in immature cells of the lung buds. From 16 dpc to postnatal day 2, no change in the basic pattern of expression (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022296 Expressed in 113 organ(s), highest expression level in brain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8VHV1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8VHV1 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CAMK2A.

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000132788

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni4 – 36Interaction with CAMK2ABy similarityAdd BLAST33

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J2Z9 Eukaryota
ENOG410Z0VT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013853

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000253947

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8VHV1

Database of Orthologous Groups

More...
OrthoDBi
1437892at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8VHV1

TreeFam database of animal gene trees

More...
TreeFami
TF330767

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009728 BAALC

The PANTHER Classification System

More...
PANTHERi
PTHR14731 PTHR14731, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06989 BAALC_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8VHV1-1) [UniParc]FASTAAdd to basket
Also known as: 1-6-8

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGCGGSRADA IEPRYYESWT RETESTWLTY TDSDALPSAA ATDSGPEAGG
60 70 80 90 100
LHAGVLEDGL SSNGVLRPAA PGGIANPEKK MNCGTQCPNS QNLSSGPLTQ
110 120 130 140
KQNGLWATEA KRDAKRMSAR EVAINVTENI RQMDRSKRVT KNCIN
Length:145
Mass (Da):15,515
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4972670A618C4D6D
GO
Isoform 2 (identifier: Q8VHV1-2) [UniParc]FASTAAdd to basket
Also known as: 1-8

The sequence of this isoform differs from the canonical sequence as follows:
     55-145: Missing.

Show »
Length:54
Mass (Da):5,667
Checksum:iFEE8C0EBFBCDB829
GO
Isoform 3 (identifier: Q8VHV1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MGCGGSRADA...SGPEAGGLHA → MPVTPVASGWLLSAHLADPFFDPWAFFSYKS

Show »
Length:123
Mass (Da):13,391
Checksum:i33DFCB5F8CFAA0AB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2I3BR56A0A2I3BR56_MOUSE
Brain and acute leukemia cytoplasmi...
Baalc
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0202051 – 53MGCGG…GGLHA → MPVTPVASGWLLSAHLADPF FDPWAFFSYKS in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_02020655 – 145Missing in isoform 2. 2 PublicationsAdd BLAST91

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF371320 mRNA Translation: AAL50516.1
AF371324 mRNA Translation: AAL50520.1
AK013358 mRNA Translation: BAB28808.1
AK079337 mRNA Translation: BAC37611.1
BC150479 mRNA Translation: AAI50480.1

NCBI Reference Sequences

More...
RefSeqi
NP_542371.1, NM_080640.5 [Q8VHV1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000163313; ENSMUSP00000132788; ENSMUSG00000022296 [Q8VHV1-3]
ENSMUST00000202657; ENSMUSP00000144590; ENSMUSG00000107249 [Q8VHV1-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
118452

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:118452

UCSC genome browser

More...
UCSCi
uc007vnx.2 mouse [Q8VHV1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF371320 mRNA Translation: AAL50516.1
AF371324 mRNA Translation: AAL50520.1
AK013358 mRNA Translation: BAB28808.1
AK079337 mRNA Translation: BAC37611.1
BC150479 mRNA Translation: AAI50480.1
RefSeqiNP_542371.1, NM_080640.5 [Q8VHV1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000132788

PTM databases

PhosphoSitePlusiQ8VHV1

Proteomic databases

PaxDbiQ8VHV1
PRIDEiQ8VHV1

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
118452

Genome annotation databases

EnsembliENSMUST00000163313; ENSMUSP00000132788; ENSMUSG00000022296 [Q8VHV1-3]
ENSMUST00000202657; ENSMUSP00000144590; ENSMUSG00000107249 [Q8VHV1-3]
GeneIDi118452
KEGGimmu:118452
UCSCiuc007vnx.2 mouse [Q8VHV1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79870
MGIiMGI:1928704 Baalc

Phylogenomic databases

eggNOGiENOG410J2Z9 Eukaryota
ENOG410Z0VT LUCA
GeneTreeiENSGT00390000013853
HOGENOMiHOG000253947
InParanoidiQ8VHV1
OrthoDBi1437892at2759
PhylomeDBiQ8VHV1
TreeFamiTF330767

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8VHV1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022296 Expressed in 113 organ(s), highest expression level in brain
ExpressionAtlasiQ8VHV1 baseline and differential
GenevisibleiQ8VHV1 MM

Family and domain databases

InterProiView protein in InterPro
IPR009728 BAALC
PANTHERiPTHR14731 PTHR14731, 1 hit
PfamiView protein in Pfam
PF06989 BAALC_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBAALC_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8VHV1
Secondary accession number(s): A9JR49, Q8VBS8, Q9CYS9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: January 23, 2007
Last modified: November 13, 2019
This is version 108 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again