Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (16 Oct 2019)
Sequence version 2 (28 Jun 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Urea transporter 1

Gene

Slc14a1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei334Important for channel permeabilityBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-425366 Transport of bile salts and organic acids, metal ions and amine compounds

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name:
UT-B
Urea transporter, erythrocyte
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc14a1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1351654 Slc14a1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei47 – 64HelicalBy similarityAdd BLAST18
Intramembranei68 – 83HelicalBy similarityAdd BLAST16
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei86 – 105HelicalBy similarityAdd BLAST20
Transmembranei110 – 132HelicalBy similarityAdd BLAST23
Transmembranei139 – 163HelicalBy similarityAdd BLAST25
Transmembranei168 – 188HelicalBy similarityAdd BLAST21
Intramembranei215 – 229HelicalBy similarityAdd BLAST15
Intramembranei234 – 245HelicalBy similarityAdd BLAST12
Transmembranei250 – 269HelicalBy similarityAdd BLAST20
Transmembranei279 – 299HelicalBy similarityAdd BLAST21
Transmembranei304 – 325HelicalBy similarityAdd BLAST22
Transmembranei328 – 348HelicalBy similarityAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutant mice exhibit grossly normal appearance, activity and behavior. Plasma sodium, potassium, chloride, bicarbonate and creatinine concentrations, as well as hematocrit, are similar to wild type animals. Urea permeability in erythrocytes is 45-fold lower than that from wild-type mice. Daily urine output is 1.5-fold greater and urine osmolarity is lower than in wild-type mice. After 24 hours of water deprivation, plasma urea concentration is 30% higher and urine urea concentration 35% lower in mutant mice than in wild-type animals. Mice lacking both Aqp1 and Slc14a1 are born at the expected Mendelian ratio, but do not thrive; half of them die within ten days after birth and none are alive after two weeks. Urine osmolality is somewhat lower than that observed with mice lacking Aqp1. Besides, erythrocyte water permeability is significantly lower than in mice lacking only Aqp1.2 Publications

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2163171

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
982

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000657381 – 384Urea transporter 1Add BLAST384

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi206N-linked (GlcNAc...) asparagineSequence analysis1
Isoform 2 (identifier: Q8VHL0-2)
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei39PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated in red blood cells, as well as in most non-erythroid tissues, except in the gastrocnemius muscle and in the gastrointestinal tract, including liver, colon and stomach.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8VHL0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8VHL0

PeptideAtlas

More...
PeptideAtlasi
Q8VHL0

PRoteomics IDEntifications database

More...
PRIDEi
Q8VHL0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8VHL0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8VHL0

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8VHL0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, kidney, heart, liver, lung, skeletal muscle, spleen, testis, ureter and urinary bladder (at protein level). Along the gastrointestinal tract, detected in colon, jejunum and stomach (at protein level). In the kidney, expressed in some microvessels of the inner and outer medulla, but not all (at protein level). Not detected in the cortex (at protein level). Detected in the urothelium all along the urinary tract, including the papilla surface, the ureter, the bladder and the urethra (at protein level). In the brain, expressed at the border of the corpus callosum and striatum in astrocytic cellular processes surrounding blood microvessels (at protein level). Detected in erythrocytes (at protein level).3 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated by water deprivation in urinary bladder and ureter, but not in kidney medulla, colon, testis nor brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000059336 Expressed in 180 organ(s), highest expression level in urinary bladder urothelium

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8VHL0 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer; each subunit contains a pore through which urea permeates.

Identified in a complex with STOM (By similarity).

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000125114

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q8VHL0

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8VHL0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the urea transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEWG Eukaryota
COG4413 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018729

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000065705

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8VHL0

KEGG Orthology (KO)

More...
KOi
K08716

Identification of Orthologs from Complete Genome Data

More...
OMAi
CPDWATA

Database of Orthologous Groups

More...
OrthoDBi
1478665at2759

TreeFam database of animal gene trees

More...
TreeFami
TF332858

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.3430.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029020 Ammonium/urea_transptr
IPR004937 Urea_transporter

The PANTHER Classification System

More...
PANTHERi
PTHR10464 PTHR10464, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03253 UT, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF016502 Urea_transporter, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8VHL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDSPTMVKV DRGENQILSC RGRRCGFKVL GYVTGDMKEF ANWLKDKPVV
60 70 80 90 100
LQFMDWILRG ISQVVFVSNP ISGILILVGL LVQNPWWALC GCVGTVVSTL
110 120 130 140 150
TALLLSQDRS AIAAGLQGYN ATLVGILMAV FSNKGDYFWW LIFPVSAMSM
160 170 180 190 200
TCPVFSSALS SVLSKWDLPV FTLPFNMALS MYLSATGHYN TFFPSKLFTP
210 220 230 240 250
VSSVPNITWS ELSALELLKS LPVGVGQIYG CDNPWTGGIF LCAILLSSPL
260 270 280 290 300
MCLHAAIGSL LGVIAGLSLA APFEDIYFGL WGFNSSLACI AIGGMFMALT
310 320 330 340 350
WQTHLLALAC ALFTAYFGAC MAHLMAVVHL PACTWSFCLA TLLFLLLTTK
360 370 380
NPNIYRMPLS KVTYSEENRI FYLQNKKRMV ESPL
Length:384
Mass (Da):42,126
Last modified:June 28, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE66ED087341C07B7
GO
Isoform 2 (identifier: Q8VHL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGQSLTGGTDDAHHGPLWIDPFGNRGDKAAPEGFRRLSLALAQRWREQEPEEEIAM

Show »
Length:440
Mass (Da):48,338
Checksum:iBA248DED75D9772A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8V → A in AAL47138 (PubMed:11792714).Curated1
Sequence conflicti50V → A in AAI00571 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0415741M → MNGQSLTGGTDDAHHGPLWI DPFGNRGDKAAPEGFRRLSL ALAQRWREQEPEEEIAM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF448798 mRNA Translation: AAL47138.1
AJ420967 mRNA Translation: CAD12807.1
AK012066 mRNA Translation: BAB28004.1
AK041979 mRNA Translation: BAC31119.1
AK153891 mRNA Translation: BAE32238.1
CH466528 Genomic DNA Translation: EDL09437.1
CH466528 Genomic DNA Translation: EDL09438.1
BC058594 mRNA Translation: AAH58594.2
BC086673 mRNA Translation: AAH86673.1
BC100570 mRNA Translation: AAI00571.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS29360.1 [Q8VHL0-1]
CCDS50330.1 [Q8VHL0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001164481.1, NM_001171010.1 [Q8VHL0-2]
NP_001164482.1, NM_001171011.1 [Q8VHL0-1]
NP_082398.1, NM_028122.4 [Q8VHL0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000091813; ENSMUSP00000089421; ENSMUSG00000059336 [Q8VHL0-1]
ENSMUST00000160292; ENSMUSP00000125114; ENSMUSG00000059336 [Q8VHL0-2]
ENSMUST00000160639; ENSMUSP00000125367; ENSMUSG00000059336 [Q8VHL0-1]
ENSMUST00000229465; ENSMUSP00000155358; ENSMUSG00000116373 [Q8VHL0-1]
ENSMUST00000229681; ENSMUSP00000155208; ENSMUSG00000116373 [Q8VHL0-1]
ENSMUST00000230088; ENSMUSP00000154891; ENSMUSG00000116373 [Q8VHL0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
108052

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:108052

UCSC genome browser

More...
UCSCi
uc008fsc.2 mouse [Q8VHL0-1]
uc008fsd.2 mouse [Q8VHL0-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF448798 mRNA Translation: AAL47138.1
AJ420967 mRNA Translation: CAD12807.1
AK012066 mRNA Translation: BAB28004.1
AK041979 mRNA Translation: BAC31119.1
AK153891 mRNA Translation: BAE32238.1
CH466528 Genomic DNA Translation: EDL09437.1
CH466528 Genomic DNA Translation: EDL09438.1
BC058594 mRNA Translation: AAH58594.2
BC086673 mRNA Translation: AAH86673.1
BC100570 mRNA Translation: AAI00571.2
CCDSiCCDS29360.1 [Q8VHL0-1]
CCDS50330.1 [Q8VHL0-2]
RefSeqiNP_001164481.1, NM_001171010.1 [Q8VHL0-2]
NP_001164482.1, NM_001171011.1 [Q8VHL0-1]
NP_082398.1, NM_028122.4 [Q8VHL0-1]

3D structure databases

SMRiQ8VHL0
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000125114

Chemistry databases

BindingDBiQ8VHL0
ChEMBLiCHEMBL2163171
GuidetoPHARMACOLOGYi982

PTM databases

iPTMnetiQ8VHL0
PhosphoSitePlusiQ8VHL0
SwissPalmiQ8VHL0

Proteomic databases

EPDiQ8VHL0
PaxDbiQ8VHL0
PeptideAtlasiQ8VHL0
PRIDEiQ8VHL0

Genome annotation databases

EnsembliENSMUST00000091813; ENSMUSP00000089421; ENSMUSG00000059336 [Q8VHL0-1]
ENSMUST00000160292; ENSMUSP00000125114; ENSMUSG00000059336 [Q8VHL0-2]
ENSMUST00000160639; ENSMUSP00000125367; ENSMUSG00000059336 [Q8VHL0-1]
ENSMUST00000229465; ENSMUSP00000155358; ENSMUSG00000116373 [Q8VHL0-1]
ENSMUST00000229681; ENSMUSP00000155208; ENSMUSG00000116373 [Q8VHL0-1]
ENSMUST00000230088; ENSMUSP00000154891; ENSMUSG00000116373 [Q8VHL0-2]
GeneIDi108052
KEGGimmu:108052
UCSCiuc008fsc.2 mouse [Q8VHL0-1]
uc008fsd.2 mouse [Q8VHL0-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6563
MGIiMGI:1351654 Slc14a1

Phylogenomic databases

eggNOGiENOG410IEWG Eukaryota
COG4413 LUCA
GeneTreeiENSGT00390000018729
HOGENOMiHOG000065705
InParanoidiQ8VHL0
KOiK08716
OMAiCPDWATA
OrthoDBi1478665at2759
TreeFamiTF332858

Enzyme and pathway databases

ReactomeiR-MMU-425366 Transport of bile salts and organic acids, metal ions and amine compounds

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Slc14a1 mouse

Protein Ontology

More...
PROi
PR:Q8VHL0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000059336 Expressed in 180 organ(s), highest expression level in urinary bladder urothelium
GenevisibleiQ8VHL0 MM

Family and domain databases

Gene3Di1.10.3430.10, 1 hit
InterProiView protein in InterPro
IPR029020 Ammonium/urea_transptr
IPR004937 Urea_transporter
PANTHERiPTHR10464 PTHR10464, 1 hit
PfamiView protein in Pfam
PF03253 UT, 1 hit
PIRSFiPIRSF016502 Urea_transporter, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUT1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8VHL0
Secondary accession number(s): Q3U542
, Q497G1, Q5RJG2, Q6PDP4, Q9CZX3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2002
Last sequence update: June 28, 2011
Last modified: October 16, 2019
This is version 123 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again