Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8VGC3 (CACB2_RAT)

Entry version 138 (17 Jun 2020)
Sequence version 2 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

Cacnb2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei544Required for CaMK2D-binding1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.4.8 5301

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-RNO-112308 Presynaptic depolarization and calcium channel opening
R-RNO-422356 Regulation of insulin secretion
R-RNO-5576892 Phase 0 - rapid depolarisation
R-RNO-5576893 Phase 2 - plateau phase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cacnb2
Synonyms:Cacnlb2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Rattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...RGDi		67385 Cacnb2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001440541 – 655Voltage-dependent L-type calcium channel subunit beta-2Add BLAST655

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei200PhosphoserineCombined sources1
Modified residuei203PhosphoserineCombined sources1
Modified residuei214PhosphoserineBy similarity1
Modified residuei545PhosphoserineBy similarity1
Modified residuei549Phosphothreonine; by CaMK2D1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Regulated through phosphorylation at Thr-549 by CaMK2D.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8VGC3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8VGC3

PRoteomics IDEntifications database

More...PRIDEi		Q8VGC3

PTM databases

CarbonylDB database of protein carbonylation sites

More...CarbonylDBi		Q8VGC3

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8VGC3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8VGC3

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8VGC3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in heart and brain, and at lower levels in lung.2 Publications

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1S) and the ancillary subunits CACNB1 or CACNB2, CACNG1 and CACNA2D1 (PubMed:26680202). The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio, i.e. it contains either CACNB1 or CACNB2 (PubMed:26680202).

Interacts with CACNA1C (PubMed:15141227).

Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane (By similarity).

Interacts with TMIGD2 (By similarity).

Interacts with CAMK2D (PubMed:20194790).

Interacts with CBARP (PubMed:24751537).

Interacts with CAMK2A (By similarity).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

Database of interacting proteins

More...DIPi		DIP-29590N

Protein interaction database and analysis system

More...IntActi		Q8VGC3, 4 interactors

STRING: functional protein association networks

More...STRINGi		10116.ENSRNOP00000037354

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1655
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8VGC3

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q8VGC3

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini110 – 179SH3PROSITE-ProRule annotationAdd BLAST70

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the calcium channel beta subunit family.Curated

Keywords - Domaini

SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3812 Eukaryota
ENOG410XRDI LUCA

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8VGC3

KEGG Orthology (KO)

More...KOi		K04863

Database of Orthologous Groups

More...OrthoDBi		926074at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8VGC3

Family and domain databases

Conserved Domains Database

More...CDDi		cd12040 SH3_CACNB2, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035605 CACNB2_SH3
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR005444 VDCC_L_b2su
IPR000584 VDCC_L_bsu

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01626 LCACHANNELB
PR01628 LCACHANNELB2

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00072 GuKc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50044 SSF50044, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8VGC3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQSDTSKSP PIAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG 
        60         70         80         90        100
SDDSTSSDTT SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ 
       110        120        130        140        150
AQLEKAKTKP VAFAVRTNVR YSAAQEDDVP VPGMAISFEA KDFLHVKEKF 
       160        170        180        190        200
NNDWWIGRLV KEGCEIGFIP SPVKLENMRL QHEQRAKQGK FYSSKSGGNS 
       210        220        230        240        250
SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR SPKPSANSVT 
       260        270        280        290        300
SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL 
       310        320        330        340        350
FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV 
       360        370        380        390        400
QSEIERIFEL ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL 
       410        420        430        440        450
QRLIKSRGKS QAKHLNVQMV AADKLAQCPP QESFDVILDE NQLEDACEHL 
       460        470        480        490        500
ADYLEAYWKA THPPSSNLPN PLLSRTLATS TLPLSPTLAS NSQGSQGDQR 
       510        520        530        540        550
TDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT GRGLSRQETF 
       560        570        580        590        600
DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREESH SSNGHRHREP 
       610        620        630        640        650
RHRTRDMGRD QDHNECSKQR SRHKSKDRYC DKEGEVISKR RSEAGEWNRD 

VYIRQ
Length:655
Mass (Da):73,226
Last modified:July 5, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0BD9B42FD4CDF52A
GO
Isoform 2 (identifier: Q8VGC3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSR

Show »
Length:604
Mass (Da):68,175
Checksum:iF877BCC720210351
GO
Isoform 3 (identifier: Q8VGC3-3) [UniParc]FASTAAdd to basket
Also known as: Beta-2c

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MVQSDTSKSPPIAAVAQESQMELLESAAPAGALGAQ → MDQASGLDRLKI

Show »
Length:631
Mass (Da):70,988
Checksum:i5406CA197EC767B4
GO
Isoform 4 (identifier: Q8VGC3-4) [UniParc]FASTAAdd to basket
Also known as: Beta-2e

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGERLKDSDIC

Show »
Length:611
Mass (Da):68,951
Checksum:i4B2044C3C706028D
GO
Isoform 5 (identifier: Q8VGC3-5) [UniParc]FASTAAdd to basket
Also known as: Beta-2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MLDRQLVSSQTQSSIPG

Show »
Length:605
Mass (Da):68,066
Checksum:i262E6837514317A4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3ZWK0D3ZWK0_RAT
Calcium channel, voltage-dependent,...
Cacnb2 rCG_55786
611Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JSZ0A0A0G2JSZ0_RAT
Calcium channel, voltage-dependent,...
Cacnb2 rCG_55786
604Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53D → G in AAO38996 (PubMed:12042350).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0107341 – 67MVQSD…SFVRQ → MQCCGLVHRRRVRVSR in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0107351 – 67MVQSD…SFVRQ → MKATWIRLLKRAKGERLKDS DIC in isoform 4. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0107361 – 67MVQSD…SFVRQ → MLDRQLVSSQTQSSIPG in isoform 5. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0107331 – 36MVQSD…ALGAQ → MDQASGLDRLKI in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF394941 mRNA Translation: AAL47074.1
M80545 mRNA Translation: AAK14821.1
AF423193 mRNA Translation: AAL16952.1
AY190119 mRNA Translation: AAO38996.1
AY190120 mRNA Translation: AAO38997.1

Protein sequence database of the Protein Information Resource

More...PIRi		A42044

NCBI Reference Sequences

More...RefSeqi		NP_446303.1, NM_053851.1
XP_006254360.1, XM_006254298.3
XP_006254365.1, XM_006254303.3 [Q8VGC3-5]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...GeneIDi		116600

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		rno:116600

UCSC genome browser

More...UCSCi		RGD:67385 rat [Q8VGC3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF394941 mRNA Translation: AAL47074.1
M80545 mRNA Translation: AAK14821.1
AF423193 mRNA Translation: AAL16952.1
AY190119 mRNA Translation: AAO38996.1
AY190120 mRNA Translation: AAO38997.1
PIRiA42044
RefSeqiNP_446303.1, NM_053851.1
XP_006254360.1, XM_006254298.3
XP_006254365.1, XM_006254303.3 [Q8VGC3-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1T0HX-ray1.97A68-196[»]
B254-476[»]
1T0JX-ray2.00A68-196[»]
B254-476[»]
3JBRelectron microscopy4.20B68-196[»]
B254-475[»]
5V2PX-ray2.00A68-189[»]
A254-476[»]
5V2QX-ray1.70A68-189[»]
A254-476[»]
SMRiQ8VGC3
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

DIPiDIP-29590N
IntActiQ8VGC3, 4 interactors
STRINGi10116.ENSRNOP00000037354

PTM databases

CarbonylDBiQ8VGC3
iPTMnetiQ8VGC3
PhosphoSitePlusiQ8VGC3
SwissPalmiQ8VGC3

Proteomic databases

jPOSTiQ8VGC3
PaxDbiQ8VGC3
PRIDEiQ8VGC3

Genome annotation databases

GeneIDi116600
KEGGirno:116600
UCSCiRGD:67385 rat [Q8VGC3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		783
RGDi67385 Cacnb2

Phylogenomic databases

eggNOGiKOG3812 Eukaryota
ENOG410XRDI LUCA
InParanoidiQ8VGC3
KOiK04863
OrthoDBi926074at2759
PhylomeDBiQ8VGC3

Enzyme and pathway databases

BRENDAi2.7.4.8 5301
ReactomeiR-RNO-112308 Presynaptic depolarization and calcium channel opening
R-RNO-422356 Regulation of insulin secretion
R-RNO-5576892 Phase 0 - rapid depolarisation
R-RNO-5576893 Phase 2 - plateau phase

Miscellaneous databases

EvolutionaryTraceiQ8VGC3

Protein Ontology

More...PROi		PR:Q8VGC3

Family and domain databases

CDDicd12040 SH3_CACNB2, 1 hit
InterProiView protein in InterPro
IPR035605 CACNB2_SH3
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR005444 VDCC_L_b2su
IPR000584 VDCC_L_bsu
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626 LCACHANNELB
PR01628 LCACHANNELB2
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCACB2_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8VGC3
Secondary accession number(s): Q811Q6
, Q811Q7, Q91ZJ8, Q9QUU7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: July 5, 2004
Last modified: June 17, 2020
This is version 138 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again