Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (16 Oct 2019)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

SH3-containing GRB2-like protein 3-interacting protein 1

Gene

Sgip1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function in clathrin-mediated endocytosis. Has both a membrane binding/tubulating activity and the ability to recruit proteins essential to the formation of functional clathrin-coated pits. Has a preference for membranes enriched in phosphatidylserine and phosphoinositides and is required for the endocytosis of the transferrin receptor. May also bind tubulin. May play a role in the regulation of energy homeostasis.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-8856825 Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828 Clathrin-mediated endocytosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SH3-containing GRB2-like protein 3-interacting protein 1
Alternative name(s):
Endophilin-3-interacting protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sgip1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1920344 Sgip1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Coated pit, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002483961 – 806SH3-containing GRB2-like protein 3-interacting protein 1Add BLAST806

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei78PhosphoserineCombined sources1
Modified residuei104PhosphoserineBy similarity1
Modified residuei105PhosphoserineBy similarity1
Modified residuei107PhosphoserineBy similarity1
Modified residuei149PhosphoserineCombined sources1
Modified residuei151PhosphoserineCombined sources1
Modified residuei156PhosphoserineCombined sources1
Modified residuei169PhosphoserineBy similarity1
Modified residuei180PhosphothreonineCombined sources1
Modified residuei182PhosphothreonineCombined sources1
Modified residuei236PhosphoserineBy similarity1
Modified residuei247PhosphothreonineCombined sources1
Modified residuei259PhosphothreonineCombined sources1
Modified residuei265PhosphoserineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei289PhosphoserineCombined sources1
Modified residuei300PhosphoserineCombined sources1
Modified residuei316PhosphoserineCombined sources1
Modified residuei319PhosphoserineCombined sources1
Modified residuei324PhosphothreonineCombined sources1
Modified residuei328PhosphothreonineCombined sources1
Modified residuei335PhosphothreonineBy similarity1
Modified residuei371PhosphoserineCombined sources1
Modified residuei398PhosphoserineCombined sources1
Modified residuei409PhosphothreonineCombined sources1
Modified residuei484PhosphoserineCombined sources1
Isoform 2 (identifier: Q8VD37-2)
Modified residuei243PhosphoserineCombined sources1
Isoform 3 (identifier: Q8VD37-3)
Modified residuei274PhosphoserineCombined sources1
Modified residuei338PhosphoserineCombined sources1
Isoform 4 (identifier: Q8VD37-4)
Modified residuei274PhosphoserineCombined sources1
Isoform 7 (identifier: Q8VD37-8)
Modified residuei505PhosphoserineCombined sources1
Isoform 6 (identifier: Q8VD37-6)
Modified residuei533PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8VD37

PeptideAtlas

More...
PeptideAtlasi
Q8VD37

PRoteomics IDEntifications database

More...
PRIDEi
Q8VD37

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8VD37

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8VD37

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8VD37

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in brain, spinal cord and cerebellum.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in the hypothalamus of obese mice.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028524 Expressed in 186 organ(s), highest expression level in retina

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8VD37 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8VD37 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with proteins essential or regulating the formation of functional clathrin-coated pits (Probable).

Interacts with CANX (PubMed:17626015, PubMed:21747946).

Interacts with AP2A1 (PubMed:17626015).

Interacts with EPS15 (PubMed:17626015).

Interacts with SH3GL3 (By similarity).

Interacts with AMPH (By similarity).

Interacts with ITSN1 (via SH3 domains) (By similarity).

Interacts with and REPS1 (By similarity).

By similarityCurated2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
215766, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8VD37, 9 interactors

Molecular INTeraction database

More...
MINTi
Q8VD37

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000079553

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8VD37

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini537 – 805MHDPROSITE-ProRule annotationAdd BLAST269

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni539 – 545Interaction with DPF motifs-containing proteinsBy similarity7
Regioni571 – 573Interaction with DPF motifs-containing proteinsBy similarity3
Regioni627 – 806Necessary and sufficient to mediate interaction with CANX1 PublicationAdd BLAST180
Regioni645 – 648Interaction with DPF motifs-containing proteinsBy similarity4
Regioni791 – 796Interaction with DPF motifs-containing proteinsBy similarity6

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi106 – 112Poly-GluSequence analysis7
Compositional biasi229 – 497Pro-richPROSITE-ProRule annotationAdd BLAST269

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2398 Eukaryota
ENOG410XTCY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156301

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231544

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8VD37

KEGG Orthology (KO)

More...
KOi
K20065

Identification of Orthologs from Complete Genome Data

More...
OMAi
NYNRLEH

Database of Orthologous Groups

More...
OrthoDBi
638761at2759

TreeFam database of animal gene trees

More...
TreeFami
TF328986

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09266 SGIP1_MHD, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036168 AP2_Mu_C_sf
IPR028565 MHD
IPR018808 Muniscin_C
IPR037984 SGIP1_MHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10291 muHD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49447 SSF49447, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51072 MHD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8VD37-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMEGLKKRTR KAFGIRKKEK DTDSTGSPDR DGMQPSPHEP PYHSKAECAR
60 70 80 90 100
EGGKKASKKS NGAPNGFYAE IDWERYNSPE LDEEGYSIRP EEPGSTKGKH
110 120 130 140 150
FYSSSESEEE EESHKKFNIK IKPLQSKDVL KNAATVDELK ASIGNIALSP
160 170 180 190 200
SPVRKSPRRS PGAIKRNLSS EEVARPRRST PTPELTSKKP LDDTLALAPL
210 220 230 240 250
FGPPLESAFD EQKTEVLLDQ PEIWGSGQPM NPSTESPELA RPFPTGTPPP
260 270 280 290 300
LPPKTVPATP PRTGSPLTVA TGNDQAATEA KIEKLPSISD LDSIFGPVLS
310 320 330 340 350
PKSVAVNTEE KWVHFSDASP EHVTPELTPR EQVVTPPAAS DIPADSPAPA
360 370 380 390 400
PPGPTGSAGP PGPPGPRHVP SPLNLEEVQK KVAEQTFIKD DYLETLSSPK
410 420 430 440 450
ECGLGQRATP PPPPPPTYRT VVSSPGPGSG SGTGTTSGAS SPARPATPLV
460 470 480 490 500
PCSTTPPPPP PRPPSRPKLP PGKPGVGDVS RPFSPPIHSS SPPPIAPLAR
510 520 530 540 550
AESTSSISST NSLSAATTPT VGSSRGPSPL TMGAQDTLPV AAAFTETVNA
560 570 580 590 600
YFKGADPSKC IVKITGEMVL SFPAGITRHF ANNPSPAALT FRVVNSSRLE
610 620 630 640 650
HVLPNPQLLC CDNTQNDANT KEFWVNMPNL MTHLKKVSEQ KPQATYYNVD
660 670 680 690 700
MLKYQVSAQG IQSTPLNLAV NWRCEPASTD LRIDYKYNTD AMSTAVALNN
710 720 730 740 750
VQFLVPIDGG VTKLQAVLPP AVWNAEQQRI LWKIPDISQK SENGGVGSLL
760 770 780 790 800
ARFQLSEGPS KPSPLVVQFT SEGSTLSGCD IELVGAGYRF SLIKKRFAAG

KYLADN
Length:806
Mass (Da):86,063
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4909A6D1DACCC775
GO
Isoform 2 (identifier: Q8VD37-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-58: Missing.
     154-161: Missing.
     272-437: Missing.

Show »
Length:608
Mass (Da):65,462
Checksum:i01294472E1F814D2
GO
Isoform 3 (identifier: Q8VD37-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: Missing.
     272-437: Missing.
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Note: No experimental confirmation available.Combined sources
Show »
Length:659
Mass (Da):71,361
Checksum:i4A2F2788CF03E9F7
GO
Isoform 4 (identifier: Q8VD37-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: Missing.
     272-437: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:639
Mass (Da):68,873
Checksum:i8EB81B8C8E8331B3
GO
Isoform 5 (identifier: Q8VD37-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-188: RKSPRRSPGAIKRNLSSEEVARPRRSTPTPELTSK → VKKLQDPGVPPQLQNLQARSLWMTLWPLLPSLVHH
     189-806: Missing.

Show »
Length:188
Mass (Da):21,052
Checksum:i869202C079926C05
GO
Isoform 6 (identifier: Q8VD37-6) [UniParc]FASTAAdd to basket
Also known as: SGIP1alpha

The sequence of this isoform differs from the canonical sequence as follows:
     33-33: M → MQGKKKAQKTQLLLTSCFWLRALSLTLSQ
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Note: The N-terminal domain (1-97) of this isoform mediates binding to and tubulation of membranes.Combined sources
Show »
Length:854
Mass (Da):91,725
Checksum:i9FB1695AA4A47D8D
GO
Isoform 7 (identifier: Q8VD37-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Show »
Length:826
Mass (Da):88,551
Checksum:i706459A1A5A74CB5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F7CPX0F7CPX0_MOUSE
SH3-containing GRB2-like protein 3-...
Sgip1
575Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6VMS8F6VMS8_MOUSE
SH3-containing GRB2-like protein 3-...
Sgip1
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti100H → Q in BAC27870 (PubMed:16141072).Curated1
Sequence conflicti250P → H in BAE28466 (PubMed:16141072).Curated1
Sequence conflicti355T → P in BAF74784 (PubMed:17626015).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04398733M → MQGKKKAQKTQLLLTSCFWL RALSLTLSQ in isoform 6. 1 Publication1
Alternative sequenceiVSP_02027934Missing in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_02028035 – 58Missing in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_020281154 – 188RKSPR…ELTSK → VKKLQDPGVPPQLQNLQARS LWMTLWPLLPSLVHH in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_020282154 – 161Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_020283189 – 806Missing in isoform 5. 1 PublicationAdd BLAST618
Alternative sequenceiVSP_020284272 – 437Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_020285521V → VENEQPSLVWFDRGKFYLTF E in isoform 3, isoform 6 and isoform 7. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB262964 mRNA Translation: BAF74784.1
AK014022 mRNA Translation: BAB29118.1
AK032439 mRNA Translation: BAC27870.1
AK043018 mRNA Translation: BAC31435.1
AK148043 mRNA Translation: BAE28309.1
AK148302 mRNA Translation: BAE28466.1
BC017596 mRNA Translation: AAH17596.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18404.1 [Q8VD37-1]
CCDS71429.1 [Q8VD37-3]
CCDS71430.1 [Q8VD37-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001272788.1, NM_001285859.1 [Q8VD37-3]
NP_001272789.1, NM_001285860.1 [Q8VD37-4]
NP_001272791.1, NM_001285862.1
NP_659155.1, NM_144906.2 [Q8VD37-1]
XP_006503491.1, XM_006503428.3 [Q8VD37-8]
XP_017175890.1, XM_017320401.1 [Q8VD37-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000066824; ENSMUSP00000063712; ENSMUSG00000028524 [Q8VD37-3]
ENSMUST00000072481; ENSMUSP00000072301; ENSMUSG00000028524 [Q8VD37-4]
ENSMUST00000080728; ENSMUSP00000079553; ENSMUSG00000028524 [Q8VD37-1]
ENSMUST00000106882; ENSMUSP00000102495; ENSMUSG00000028524 [Q8VD37-8]
ENSMUST00000183855; ENSMUSP00000139337; ENSMUSG00000028524 [Q8VD37-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
73094

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:73094

UCSC genome browser

More...
UCSCi
uc008two.2 mouse [Q8VD37-1]
uc008twq.2 mouse [Q8VD37-6]
uc008twr.2 mouse [Q8VD37-3]
uc008tws.2 mouse [Q8VD37-4]
uc008twt.2 mouse [Q8VD37-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB262964 mRNA Translation: BAF74784.1
AK014022 mRNA Translation: BAB29118.1
AK032439 mRNA Translation: BAC27870.1
AK043018 mRNA Translation: BAC31435.1
AK148043 mRNA Translation: BAE28309.1
AK148302 mRNA Translation: BAE28466.1
BC017596 mRNA Translation: AAH17596.1
CCDSiCCDS18404.1 [Q8VD37-1]
CCDS71429.1 [Q8VD37-3]
CCDS71430.1 [Q8VD37-4]
RefSeqiNP_001272788.1, NM_001285859.1 [Q8VD37-3]
NP_001272789.1, NM_001285860.1 [Q8VD37-4]
NP_001272791.1, NM_001285862.1
NP_659155.1, NM_144906.2 [Q8VD37-1]
XP_006503491.1, XM_006503428.3 [Q8VD37-8]
XP_017175890.1, XM_017320401.1 [Q8VD37-1]

3D structure databases

SMRiQ8VD37
ModBaseiSearch...

Protein-protein interaction databases

BioGridi215766, 2 interactors
IntActiQ8VD37, 9 interactors
MINTiQ8VD37
STRINGi10090.ENSMUSP00000079553

PTM databases

iPTMnetiQ8VD37
PhosphoSitePlusiQ8VD37
SwissPalmiQ8VD37

Proteomic databases

PaxDbiQ8VD37
PeptideAtlasiQ8VD37
PRIDEiQ8VD37

Genome annotation databases

EnsembliENSMUST00000066824; ENSMUSP00000063712; ENSMUSG00000028524 [Q8VD37-3]
ENSMUST00000072481; ENSMUSP00000072301; ENSMUSG00000028524 [Q8VD37-4]
ENSMUST00000080728; ENSMUSP00000079553; ENSMUSG00000028524 [Q8VD37-1]
ENSMUST00000106882; ENSMUSP00000102495; ENSMUSG00000028524 [Q8VD37-8]
ENSMUST00000183855; ENSMUSP00000139337; ENSMUSG00000028524 [Q8VD37-5]
GeneIDi73094
KEGGimmu:73094
UCSCiuc008two.2 mouse [Q8VD37-1]
uc008twq.2 mouse [Q8VD37-6]
uc008twr.2 mouse [Q8VD37-3]
uc008tws.2 mouse [Q8VD37-4]
uc008twt.2 mouse [Q8VD37-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84251
MGIiMGI:1920344 Sgip1

Phylogenomic databases

eggNOGiKOG2398 Eukaryota
ENOG410XTCY LUCA
GeneTreeiENSGT00940000156301
HOGENOMiHOG000231544
InParanoidiQ8VD37
KOiK20065
OMAiNYNRLEH
OrthoDBi638761at2759
TreeFamiTF328986

Enzyme and pathway databases

ReactomeiR-MMU-8856825 Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828 Clathrin-mediated endocytosis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sgip1 mouse

Protein Ontology

More...
PROi
PR:Q8VD37

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028524 Expressed in 186 organ(s), highest expression level in retina
ExpressionAtlasiQ8VD37 baseline and differential
GenevisibleiQ8VD37 MM

Family and domain databases

CDDicd09266 SGIP1_MHD, 1 hit
InterProiView protein in InterPro
IPR036168 AP2_Mu_C_sf
IPR028565 MHD
IPR018808 Muniscin_C
IPR037984 SGIP1_MHD
PfamiView protein in Pfam
PF10291 muHD, 1 hit
SUPFAMiSSF49447 SSF49447, 1 hit
PROSITEiView protein in PROSITE
PS51072 MHD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSGIP1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8VD37
Secondary accession number(s): A7BFW0
, Q3UFU3, Q3UGA0, Q8BXX4, Q8C034, Q9CXT2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: March 1, 2002
Last modified: October 16, 2019
This is version 123 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again