Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 242

Gene

Tmem242

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 242
Gene namesi
Name:Tmem242
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1917794 Tmem242

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei29 – 49HelicalSequence analysisAdd BLAST21
Transmembranei81 – 101HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002958491 – 140Transmembrane protein 242Add BLAST140

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ8VCR3
PaxDbiQ8VCR3
PeptideAtlasiQ8VCR3
PRIDEiQ8VCR3

PTM databases

PhosphoSitePlusiQ8VCR3

Expressioni

Gene expression databases

BgeeiENSMUSG00000004945 Expressed in 263 organ(s), highest expression level in brown adipose tissue
CleanExiMM_5730437N04RIK
GenevisibleiQ8VCR3 MM

Family & Domainsi

Sequence similaritiesi

Belongs to the TMEM242 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IVW9 Eukaryota
ENOG4111SBW LUCA
GeneTreeiENSGT00390000008642
HOGENOMiHOG000047628
HOVERGENiHBG057272
InParanoidiQ8VCR3
OMAiQEFRLKM
OrthoDBiEOG091G0YBU
PhylomeDBiQ8VCR3
TreeFamiTF323317

Family and domain databases

InterProiView protein in InterPro
IPR009792 TMEM242
PANTHERiPTHR13141 PTHR13141, 1 hit
PfamiView protein in Pfam
PF07096 DUF1358, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8VCR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METSGPGPGE SSELEAPGSP DDRLFLVKGG IFLGSAAAAG MLAGFVTTLS
60 70 80 90 100
LAKKKSPEWF NKGTMATAAL PESGSSLALR ALGWGSLYAW CGVGVISFAV
110 120 130 140
WKALGVHSMK DFRSKMQSIF PPIPKNHESA EEWEEVLKWK
Length:140
Mass (Da):14,916
Last modified:March 1, 2002 - v1
Checksum:iAF42EC70C1AED3D8
GO
Isoform 2 (identifier: Q8VCR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-140: MKDFRSKMQSIFPPIPKNHESAEEWEEVLKWK → VSTSPCESCLSTLCCLKFLVFKFAYILVPVF

Show »
Length:139
Mass (Da):14,429
Checksum:i2FE7613C0B872149
GO
Isoform 3 (identifier: Q8VCR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-118: MKDFRSKMQS → ALFDCREETR
     119-140: Missing.

Show »
Length:118
Mass (Da):12,209
Checksum:iA52CD7BFEEBF48E7
GO

Sequence cautioni

The sequence BAC25272 differs from that shown. Reason: Frameshift at position 137.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti18G → R in BAC40103 (PubMed:16141072).Curated1
Sequence conflicti18G → R in BAE33193 (PubMed:16141072).Curated1
Sequence conflicti127H → R in BAC40103 (PubMed:16141072).Curated1
Sequence conflicti127H → R in BAE33193 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027110109 – 140MKDFR…VLKWK → VSTSPCESCLSTLCCLKFLV FKFAYILVPVF in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027111109 – 118MKDFRSKMQS → ALFDCREETR in isoform 3. 1 Publication10
Alternative sequenceiVSP_027112119 – 140Missing in isoform 3. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK003559 mRNA Translation: BAB22856.1
AK009851 mRNA Translation: BAC25272.1 Frameshift.
AK017626 mRNA Translation: BAB30845.1
AK088025 mRNA Translation: BAC40103.1
AK155326 mRNA Translation: BAE33193.1
AK158107 mRNA Translation: BAE34359.1
BC019420 mRNA Translation: AAH19420.1
CCDSiCCDS49930.1 [Q8VCR3-1]
RefSeqiNP_081733.3, NM_027457.4 [Q8VCR3-1]
UniGeneiMm.46654

Genome annotation databases

EnsembliENSMUST00000005053; ENSMUSP00000005053; ENSMUSG00000004945 [Q8VCR3-1]
ENSMUST00000185896; ENSMUSP00000139712; ENSMUSG00000004945 [Q8VCR3-2]
ENSMUST00000188282; ENSMUSP00000139629; ENSMUSG00000004945 [Q8VCR3-3]
GeneIDi70544
KEGGimmu:70544
UCSCiuc008afa.1 mouse [Q8VCR3-1]
uc008afc.1 mouse [Q8VCR3-3]
uc008afd.1 mouse [Q8VCR3-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK003559 mRNA Translation: BAB22856.1
AK009851 mRNA Translation: BAC25272.1 Frameshift.
AK017626 mRNA Translation: BAB30845.1
AK088025 mRNA Translation: BAC40103.1
AK155326 mRNA Translation: BAE33193.1
AK158107 mRNA Translation: BAE34359.1
BC019420 mRNA Translation: AAH19420.1
CCDSiCCDS49930.1 [Q8VCR3-1]
RefSeqiNP_081733.3, NM_027457.4 [Q8VCR3-1]
UniGeneiMm.46654

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSitePlusiQ8VCR3

Proteomic databases

EPDiQ8VCR3
PaxDbiQ8VCR3
PeptideAtlasiQ8VCR3
PRIDEiQ8VCR3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000005053; ENSMUSP00000005053; ENSMUSG00000004945 [Q8VCR3-1]
ENSMUST00000185896; ENSMUSP00000139712; ENSMUSG00000004945 [Q8VCR3-2]
ENSMUST00000188282; ENSMUSP00000139629; ENSMUSG00000004945 [Q8VCR3-3]
GeneIDi70544
KEGGimmu:70544
UCSCiuc008afa.1 mouse [Q8VCR3-1]
uc008afc.1 mouse [Q8VCR3-3]
uc008afd.1 mouse [Q8VCR3-2]

Organism-specific databases

CTDi729515
MGIiMGI:1917794 Tmem242

Phylogenomic databases

eggNOGiENOG410IVW9 Eukaryota
ENOG4111SBW LUCA
GeneTreeiENSGT00390000008642
HOGENOMiHOG000047628
HOVERGENiHBG057272
InParanoidiQ8VCR3
OMAiQEFRLKM
OrthoDBiEOG091G0YBU
PhylomeDBiQ8VCR3
TreeFamiTF323317

Miscellaneous databases

ChiTaRSiTmem242 mouse
PROiPR:Q8VCR3
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000004945 Expressed in 263 organ(s), highest expression level in brown adipose tissue
CleanExiMM_5730437N04RIK
GenevisibleiQ8VCR3 MM

Family and domain databases

InterProiView protein in InterPro
IPR009792 TMEM242
PANTHERiPTHR13141 PTHR13141, 1 hit
PfamiView protein in Pfam
PF07096 DUF1358, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTM242_MOUSE
AccessioniPrimary (citable) accession number: Q8VCR3
Secondary accession number(s): Q8C2T2
, Q8CEX9, Q9CYJ2, Q9D1H4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: March 1, 2002
Last modified: November 7, 2018
This is version 90 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again