Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (12 Aug 2020)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Soluble calcium-activated nucleotidase 1

Gene

Cant1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > IDP >> UTP > CDP = GTP = ITP. Has very low activity towards ADP and even lower activity towards ATP. Does not hydrolyze AMP and GMP. Involved in proteoglycan synthesis.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei162Important for dimer formationBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi170Calcium; via carbonyl oxygenBy similarity1
Metal bindingi171CalciumBy similarity1
Sitei202Important for dimer formationBy similarity1
Sitei204Important for dimer formationBy similarity1
Metal bindingi217Calcium; via carbonyl oxygenBy similarity1
Sitei258Important for dimer formationBy similarity1
Metal bindingi286Calcium; via carbonyl oxygenBy similarity1
Metal bindingi347Calcium; via carbonyl oxygenBy similarity1
Metal bindingi398Calcium; via carbonyl oxygenBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-6798695, Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Soluble calcium-activated nucleotidase 1 (EC:3.6.1.6By similarity)
Short name:
SCAN-1
Alternative name(s):
Apyrase homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cant1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1923275, Cant1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 44CytoplasmicSequence analysisAdd BLAST44
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei45 – 61Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini62 – 403LumenalSequence analysisAdd BLAST342

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002099261 – 403Soluble calcium-activated nucleotidase 1Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi90N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8VCF1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8VCF1

PeptideAtlas

More...
PeptideAtlasi
Q8VCF1

PRoteomics IDEntifications database

More...
PRIDEi
Q8VCF1

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8VCF1, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8VCF1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8VCF1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000025575, Expressed in stomach and 305 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8VCF1, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Homodimer; dimerization is Ca2+-dependent.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000090032

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8VCF1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8VCF1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the apyrase family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4494, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012872

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_047493_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8VCF1

KEGG Orthology (KO)

More...
KOi
K12304

Identification of Orthologs from Complete Genome Data

More...
OMAi
RTGLIYE

Database of Orthologous Groups

More...
OrthoDBi
1126948at2759

TreeFam database of animal gene trees

More...
TreeFami
TF315248

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.120.10.100, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009283, Apyrase
IPR036258, Apyrase_sf

The PANTHER Classification System

More...
PANTHERi
PTHR13023, PTHR13023, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101887, SSF101887, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8VCF1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPIQPFDQRE WNEPMHSLRI SVGGLPVLAS MTKATDPRFR PRWRVILTSF
60 70 80 90 100
VGAALLWLLY SHHQGPVPGR PPTHNAHNWR LSQQRISHYN DTYPLSPPQR
110 120 130 140 150
TPGGIRYRIA VIADLDTGSR AQEENTWFSY LKKGYLTLSD SGDRVSVEWD
160 170 180 190 200
KDHGVLESHL AEKGRGMELS DLIVFNGKLY SVDDRTGVIY QIEGTKAVPW
210 220 230 240 250
VILSDGDGTV EKGFKAEWLA VKDEHLYVGG LGKEWTTTTG EVMNENPEWV
260 270 280 290 300
KVVGHRGSVD HENWVSSYNA LRAAAGIRPP GYLIHESACW SDTLQRWFFL
310 320 330 340 350
PRRASHERYS EKDDERKGSN LLLSAAQDFR DISVRQVGTL IPTHGFSSFK
360 370 380 390 400
FIPNTDDQII VALKSEEDNG RIATYVMAFT LDGRFLLPET KIGTVKYEGI

EFI
Length:403
Mass (Da):45,653
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0CB2BC618CD4714E
GO
Isoform 2 (identifier: Q8VCF1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-214: F → K
     215-403: Missing.

Show »
Length:214
Mass (Da):24,189
Checksum:i7B0A7526CCF0FBB5
GO
Isoform 3 (identifier: Q8VCF1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-213: G → GQLLLLSLALSPPSTRVCMLSSNDSWEQNLILASCVAG

Show »
Length:440
Mass (Da):49,566
Checksum:i5B5DA87E19879644
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB31014 differs from that shown. Reason: Frameshift.Curated
The sequence BAC39351 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8Q → E in BAC38139 (PubMed:16141072).Curated1
Sequence conflicti113A → G in BAC38139 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013762213G → GQLLLLSLALSPPSTRVCML SSNDSWEQNLILASCVAG in isoform 3. 1 Publication1
Alternative sequenceiVSP_013763214F → K in isoform 2. 1 Publication1
Alternative sequenceiVSP_013764215 – 403Missing in isoform 2. 1 PublicationAdd BLAST189

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK006565 mRNA Translation: BAB24655.1
AK017942 mRNA Translation: BAB31014.1 Frameshift.
AK049879 mRNA Translation: BAC33968.1
AK081118 mRNA Translation: BAC38139.1
AK085059 mRNA Translation: BAC39351.1 Frameshift.
AL591404 Genomic DNA No translation available.
BC020003 mRNA Translation: AAH20003.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25702.1 [Q8VCF1-1]
CCDS59572.1 [Q8VCF1-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001020788.1, NM_001025617.2 [Q8VCF1-1]
NP_001020789.1, NM_001025618.2 [Q8VCF1-1]
NP_001254520.1, NM_001267591.1 [Q8VCF1-1]
NP_001254521.1, NM_001267592.1 [Q8VCF1-3]
NP_083778.2, NM_029502.3 [Q8VCF1-1]
XP_006534467.1, XM_006534404.2 [Q8VCF1-3]
XP_006534468.1, XM_006534405.2 [Q8VCF1-3]
XP_006534469.1, XM_006534406.2 [Q8VCF1-3]
XP_006534470.1, XM_006534407.2 [Q8VCF1-3]
XP_006534471.1, XM_006534408.3 [Q8VCF1-3]
XP_006534472.1, XM_006534409.1 [Q8VCF1-3]
XP_006534473.1, XM_006534410.3 [Q8VCF1-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000017620; ENSMUSP00000017620; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000092378; ENSMUSP00000090032; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106287; ENSMUSP00000101894; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106288; ENSMUSP00000101895; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106289; ENSMUSP00000101896; ENSMUSG00000025575 [Q8VCF1-3]
ENSMUST00000164927; ENSMUSP00000126919; ENSMUSG00000025575 [Q8VCF1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
76025

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:76025

UCSC genome browser

More...
UCSCi
uc007mpa.2, mouse [Q8VCF1-1]
uc007mpf.2, mouse [Q8VCF1-2]
uc011yin.2, mouse [Q8VCF1-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006565 mRNA Translation: BAB24655.1
AK017942 mRNA Translation: BAB31014.1 Frameshift.
AK049879 mRNA Translation: BAC33968.1
AK081118 mRNA Translation: BAC38139.1
AK085059 mRNA Translation: BAC39351.1 Frameshift.
AL591404 Genomic DNA No translation available.
BC020003 mRNA Translation: AAH20003.1
CCDSiCCDS25702.1 [Q8VCF1-1]
CCDS59572.1 [Q8VCF1-3]
RefSeqiNP_001020788.1, NM_001025617.2 [Q8VCF1-1]
NP_001020789.1, NM_001025618.2 [Q8VCF1-1]
NP_001254520.1, NM_001267591.1 [Q8VCF1-1]
NP_001254521.1, NM_001267592.1 [Q8VCF1-3]
NP_083778.2, NM_029502.3 [Q8VCF1-1]
XP_006534467.1, XM_006534404.2 [Q8VCF1-3]
XP_006534468.1, XM_006534405.2 [Q8VCF1-3]
XP_006534469.1, XM_006534406.2 [Q8VCF1-3]
XP_006534470.1, XM_006534407.2 [Q8VCF1-3]
XP_006534471.1, XM_006534408.3 [Q8VCF1-3]
XP_006534472.1, XM_006534409.1 [Q8VCF1-3]
XP_006534473.1, XM_006534410.3 [Q8VCF1-3]

3D structure databases

SMRiQ8VCF1
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000090032

PTM databases

GlyGeniQ8VCF1, 1 site
iPTMnetiQ8VCF1
PhosphoSitePlusiQ8VCF1

Proteomic databases

EPDiQ8VCF1
PaxDbiQ8VCF1
PeptideAtlasiQ8VCF1
PRIDEiQ8VCF1

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
19748, 319 antibodies

The DNASU plasmid repository

More...
DNASUi
76025

Genome annotation databases

EnsembliENSMUST00000017620; ENSMUSP00000017620; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000092378; ENSMUSP00000090032; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106287; ENSMUSP00000101894; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106288; ENSMUSP00000101895; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106289; ENSMUSP00000101896; ENSMUSG00000025575 [Q8VCF1-3]
ENSMUST00000164927; ENSMUSP00000126919; ENSMUSG00000025575 [Q8VCF1-1]
GeneIDi76025
KEGGimmu:76025
UCSCiuc007mpa.2, mouse [Q8VCF1-1]
uc007mpf.2, mouse [Q8VCF1-2]
uc011yin.2, mouse [Q8VCF1-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
124583
MGIiMGI:1923275, Cant1

Phylogenomic databases

eggNOGiKOG4494, Eukaryota
GeneTreeiENSGT00390000012872
HOGENOMiCLU_047493_0_0_1
InParanoidiQ8VCF1
KOiK12304
OMAiRTGLIYE
OrthoDBi1126948at2759
TreeFamiTF315248

Enzyme and pathway databases

ReactomeiR-MMU-6798695, Neutrophil degranulation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
76025, 2 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Cant1, mouse

Protein Ontology

More...
PROi
PR:Q8VCF1
RNActiQ8VCF1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000025575, Expressed in stomach and 305 other tissues
GenevisibleiQ8VCF1, MM

Family and domain databases

Gene3Di2.120.10.100, 1 hit
InterProiView protein in InterPro
IPR009283, Apyrase
IPR036258, Apyrase_sf
PANTHERiPTHR13023, PTHR13023, 1 hit
SUPFAMiSSF101887, SSF101887, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCANT1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8VCF1
Secondary accession number(s): B1AQJ8
, Q8C3R8, Q8C4T6, Q9D3F2, Q9D9R1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: March 1, 2002
Last modified: August 12, 2020
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again