Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (12 Aug 2020)
Sequence version 2 (18 Apr 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

HMG box transcription factor BBX

Gene

Bbx

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that is necessary for cell cycle progression from G1 to S phase.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi80 – 148HMG boxPROSITE-ProRule annotationAdd BLAST69

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
HMG box transcription factor BBX
Alternative name(s):
Bobby sox homolog
HMG box-containing protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Bbx
Synonyms:Hbp2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1917758, Bbx

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002328861 – 907HMG box transcription factor BBXAdd BLAST907

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei242PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki384Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei476PhosphoserineCombined sources1
Modified residuei483PhosphoserineBy similarity1
Cross-linki571Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki693Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei701PhosphoserineBy similarity1
Modified residuei789PhosphoserineBy similarity1
Modified residuei811PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8VBW5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8VBW5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8VBW5

PeptideAtlas

More...
PeptideAtlasi
Q8VBW5

PRoteomics IDEntifications database

More...
PRIDEi
Q8VBW5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8VBW5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8VBW5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022641, Expressed in placenta and 290 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8VBW5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
214101, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000119238

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8VBW5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1907
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8VBW5

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8VBW5

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi41 – 50Poly-Glu10
Compositional biasi444 – 540Lys-richAdd BLAST97
Compositional biasi715 – 718Poly-Lys4

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2746, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158592

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_017230_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8VBW5

KEGG Orthology (KO)

More...
KOi
K21643

Identification of Orthologs from Complete Genome Data

More...
OMAi
SPMTFDK

Database of Orthologous Groups

More...
OrthoDBi
1641977at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8VBW5

TreeFam database of animal gene trees

More...
TreeFami
TF106402

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.30.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009071, HMG_box_dom
IPR036910, HMG_box_dom_sf
IPR019102, TF_HMG_box_BBX_DUF2028

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09667, DUF2028, 1 hit
PF00505, HMG_box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00398, HMG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47095, SSF47095, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50118, HMG_BOX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8VBW5-1) [UniParc]FASTAAdd to basket
Also known as: BbxA

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKGSNRNKDH STEGEGDGKR PKRKCLQWHP LLAKKLLDFS EEEEEDEEEE
60 70 80 90 100
DIDKVQLLEA DGLEQDVAET EDDESPEQRA RRPMNAFLLF CKRHRSLVRQ
110 120 130 140 150
EHPRLDNRGA TKILADWWAV LDPKEKQKYT DMAKEYKDAF MKANPGYRWC
160 170 180 190 200
PTTNKPVKSP TPTVNPRKKL WAFPPDSSRD LPTPKKAKTE VPQLNFGMAD
210 220 230 240 250
PTQMGGLSML LLAGEHALGT PEASSGTCRP DISESPELRQ KSPLFQFAEI
260 270 280 290 300
SSRTSHPDAP SKQCQASALF QFAEISSSTS QLGGTEPVKR CGNSALFQLA
310 320 330 340 350
EMCLASEGVK MEDTKLIKSK ESDGGRIEEI EKGKEERGTE VEKTTETSFQ
360 370 380 390 400
KEAEFGKSAK GNVRESKDLR DIEQLQMDNV MAIKVEDPKE IRKEPEDDQK
410 420 430 440 450
YSHFPDFSYS ASSKIIISGV PSRKDHMCHP HGIMIIEDPT TLNKPEKIKK
460 470 480 490 500
KKKKNKLDRH GNDKSTPKKT CKKRQSSESD IESVMYTIEA VAKGDWGVDK
510 520 530 540 550
LGETPRKKVR PSSSGKGGIL DAKPPKKKVK SKEKKVSKEK CSDITKESRP
560 570 580 590 600
PDFLSISASK SVPGEVPEGI KAEPLTPTED ALPPSLPGQA KPEDSDCHRK
610 620 630 640 650
TETCGSRKSE RSCKGALYKT LVSEGMLTSL RANVDRGKRS SGKGNSSDHE
660 670 680 690 700
GCWSEESWTF NQSGTSGSKK FKKKLREDSF LGSAKLDEEF EKKFNSLPQY
710 720 730 740 750
SPITFDRKCV STPRKKKKTG NMSSESTKTS KGSGDKWSHK QFFLDAIHPT
760 770 780 790 800
EAIFSEDKST TEPAFKVKNA LSIPNTPEPT TMQEPLVGSQ KRKARKTKIT
810 820 830 840 850
HLVRTADGRV SPAGGTLDDK PKEQLQRSLP KVPGTYCGDN CSHSTVEEPR
860 870 880 890 900
SSTPDMPAVS AFFSLAALAE VAAMENVHRG QRSTPLTHDG QPKEMPQAPV

LISCADQ
Length:907
Mass (Da):100,783
Last modified:April 18, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i53E113D4B3DE4DAC
GO
Isoform 2 (identifier: Q8VBW5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-135: Missing.
     223-249: Missing.
     730-730: S → SKGPFQSQKKNLFHKIVSKYKHKKEKPNVPE

Show »
Length:829
Mass (Da):91,878
Checksum:i3685A4E65B4A64EF
GO
Isoform 3 (identifier: Q8VBW5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     732-751: Missing.

Show »
Length:887
Mass (Da):98,500
Checksum:iB1913D47BAE14B1C
GO
Isoform 4 (identifier: Q8VBW5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     733-750: SGDKWSHKQFFLDAIHPT → PFQSQKKNLFHKIVSKYK
     751-907: Missing.

Show »
Length:750
Mass (Da):83,986
Checksum:i5035FF87DBAEAF10
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL68987 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAL68988 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti269L → F in AAL58872 (Ref. 1) Curated1
Sequence conflicti269L → F in AAL58873 (Ref. 1) Curated1
Sequence conflicti269L → F in BAB30768 (PubMed:16141072).Curated1
Sequence conflicti450K → R in BAC34285 (PubMed:16141072).Curated1
Sequence conflicti455N → T in AAL58872 (Ref. 1) Curated1
Sequence conflicti455N → T in AAL58873 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti30P → L in strain: C3H/He. 1 Publication1
Natural varianti281Q → H in strain: C3H/He. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01800755 – 135Missing in isoform 2. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_018008223 – 249Missing in isoform 2. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_018009730S → SKGPFQSQKKNLFHKIVSKY KHKKEKPNVPE in isoform 2. 1 Publication1
Alternative sequenceiVSP_018010732 – 751Missing in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_018011733 – 750SGDKW…AIHPT → PFQSQKKNLFHKIVSKYK in isoform 4. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_018012751 – 907Missing in isoform 4. 1 PublicationAdd BLAST157

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF454943 mRNA Translation: AAL58872.1
AF454944 mRNA Translation: AAL58873.1
AK017487 mRNA Translation: BAB30768.1
AK029532 mRNA Translation: BAC26500.2
AK029747 mRNA Translation: BAC26596.1
AK049516 mRNA Translation: BAC33788.1
AK050488 mRNA Translation: BAC34285.1
AK157813 mRNA Translation: BAE34207.1
AC109627 Genomic DNA No translation available.
CT571273 Genomic DNA No translation available.
BC057869 mRNA Translation: AAH57869.1
BC066821 mRNA Translation: AAH66821.1
AF276950 mRNA Translation: AAL68986.1
AF276951 mRNA Translation: AAL68987.1 Sequence problems.
AF276952 mRNA Translation: AAL68988.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37354.1 [Q8VBW5-1]
CCDS84241.1 [Q8VBW5-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001334169.1, NM_001347240.1 [Q8VBW5-3]
NP_081720.2, NM_027444.3 [Q8VBW5-1]
XP_011244310.1, XM_011246008.2 [Q8VBW5-1]
XP_011244311.1, XM_011246009.1 [Q8VBW5-3]
XP_017172619.1, XM_017317130.1 [Q8VBW5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000066037; ENSMUSP00000066384; ENSMUSG00000022641 [Q8VBW5-2]
ENSMUST00000089399; ENSMUSP00000086821; ENSMUSG00000022641 [Q8VBW5-4]
ENSMUST00000089404; ENSMUSP00000086826; ENSMUSG00000022641 [Q8VBW5-3]
ENSMUST00000114488; ENSMUSP00000110132; ENSMUSG00000022641 [Q8VBW5-1]
ENSMUST00000138166; ENSMUSP00000119238; ENSMUSG00000022641 [Q8VBW5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
70508

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:70508

UCSC genome browser

More...
UCSCi
uc007zkn.2, mouse [Q8VBW5-1]
uc007zkp.2, mouse [Q8VBW5-3]
uc007zkq.2, mouse [Q8VBW5-2]
uc007zkr.2, mouse [Q8VBW5-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF454943 mRNA Translation: AAL58872.1
AF454944 mRNA Translation: AAL58873.1
AK017487 mRNA Translation: BAB30768.1
AK029532 mRNA Translation: BAC26500.2
AK029747 mRNA Translation: BAC26596.1
AK049516 mRNA Translation: BAC33788.1
AK050488 mRNA Translation: BAC34285.1
AK157813 mRNA Translation: BAE34207.1
AC109627 Genomic DNA No translation available.
CT571273 Genomic DNA No translation available.
BC057869 mRNA Translation: AAH57869.1
BC066821 mRNA Translation: AAH66821.1
AF276950 mRNA Translation: AAL68986.1
AF276951 mRNA Translation: AAL68987.1 Sequence problems.
AF276952 mRNA Translation: AAL68988.1 Different initiation.
CCDSiCCDS37354.1 [Q8VBW5-1]
CCDS84241.1 [Q8VBW5-3]
RefSeqiNP_001334169.1, NM_001347240.1 [Q8VBW5-3]
NP_081720.2, NM_027444.3 [Q8VBW5-1]
XP_011244310.1, XM_011246008.2 [Q8VBW5-1]
XP_011244311.1, XM_011246009.1 [Q8VBW5-3]
XP_017172619.1, XM_017317130.1 [Q8VBW5-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WZ6NMR-A80-148[»]
SMRiQ8VBW5
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi214101, 1 interactor
STRINGi10090.ENSMUSP00000119238

PTM databases

iPTMnetiQ8VBW5
PhosphoSitePlusiQ8VBW5

Proteomic databases

EPDiQ8VBW5
jPOSTiQ8VBW5
PaxDbiQ8VBW5
PeptideAtlasiQ8VBW5
PRIDEiQ8VBW5

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
32337, 107 antibodies

Genome annotation databases

EnsembliENSMUST00000066037; ENSMUSP00000066384; ENSMUSG00000022641 [Q8VBW5-2]
ENSMUST00000089399; ENSMUSP00000086821; ENSMUSG00000022641 [Q8VBW5-4]
ENSMUST00000089404; ENSMUSP00000086826; ENSMUSG00000022641 [Q8VBW5-3]
ENSMUST00000114488; ENSMUSP00000110132; ENSMUSG00000022641 [Q8VBW5-1]
ENSMUST00000138166; ENSMUSP00000119238; ENSMUSG00000022641 [Q8VBW5-1]
GeneIDi70508
KEGGimmu:70508
UCSCiuc007zkn.2, mouse [Q8VBW5-1]
uc007zkp.2, mouse [Q8VBW5-3]
uc007zkq.2, mouse [Q8VBW5-2]
uc007zkr.2, mouse [Q8VBW5-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56987
MGIiMGI:1917758, Bbx

Phylogenomic databases

eggNOGiKOG2746, Eukaryota
GeneTreeiENSGT00940000158592
HOGENOMiCLU_017230_0_0_1
InParanoidiQ8VBW5
KOiK21643
OMAiSPMTFDK
OrthoDBi1641977at2759
PhylomeDBiQ8VBW5
TreeFamiTF106402

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
70508, 2 hits in 19 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Bbx, mouse
EvolutionaryTraceiQ8VBW5

Protein Ontology

More...
PROi
PR:Q8VBW5
RNActiQ8VBW5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022641, Expressed in placenta and 290 other tissues
GenevisibleiQ8VBW5, MM

Family and domain databases

Gene3Di1.10.30.10, 1 hit
InterProiView protein in InterPro
IPR009071, HMG_box_dom
IPR036910, HMG_box_dom_sf
IPR019102, TF_HMG_box_BBX_DUF2028
PfamiView protein in Pfam
PF09667, DUF2028, 1 hit
PF00505, HMG_box, 1 hit
SMARTiView protein in SMART
SM00398, HMG, 1 hit
SUPFAMiSSF47095, SSF47095, 1 hit
PROSITEiView protein in PROSITE
PS50118, HMG_BOX_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBBX_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8VBW5
Secondary accession number(s): B8JK46
, B8JK47, B8JK48, B8JK49, Q3TZK1, Q6NXY8, Q6PEU3, Q8BQJ7, Q8C7E0, Q8CDQ0, Q8CDV1, Q8VI48, Q8VI49, Q8VI50, Q9CS94
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: April 18, 2006
Last modified: August 12, 2020
This is version 128 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again