Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein Shroom3

Gene

SHROOM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Controls cell shape changes in the neuroepithelium during neural tube closure. Induces apical constriction in epithelial cells by promoting the apical accumulation of F-actin and myosin II, and probably by bundling stress fibers. Induces apicobasal cell elongation by redistributing gamma-tubulin and directing the assembly of robust apicobasal microtubule arrays (By similarity).By similarity

Caution

It is uncertain whether Met-1 or Met-2 is the initiator. Met-2 is more conserved than Met-1 among the orthologs.Curated

GO - Molecular functioni

  • actin filament binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionActin-binding, Developmental protein
Biological processCell shape

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Shroom3
Alternative name(s):
Shroom-related protein
Short name:
hShrmL
Gene namesi
Name:SHROOM3
Synonyms:KIAA1481, SHRML
ORF Names:MSTP013
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000138771.14
HGNCiHGNC:30422 SHROOM3
MIMi604570 gene
neXtProtiNX_Q8TF72

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi57619
OpenTargetsiENSG00000138771
PharmGKBiPA147357295

Polymorphism and mutation databases

BioMutaiSHROOM3
DMDMi300669666

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002860661 – 1996Protein Shroom3Add BLAST1996

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei213PhosphoserineBy similarity1
Modified residuei439PhosphoserineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei816PhosphoserineCombined sources1
Modified residuei890PhosphoserineCombined sources1
Modified residuei910PhosphoserineCombined sources1
Modified residuei913PhosphoserineCombined sources1
Modified residuei970PhosphoserineCombined sources1
Modified residuei1069PhosphoserineBy similarity1
Modified residuei1072PhosphoserineBy similarity1
Modified residuei1221PhosphoserineCombined sources1
Modified residuei1441PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TF72
MaxQBiQ8TF72
PaxDbiQ8TF72
PeptideAtlasiQ8TF72
PRIDEiQ8TF72
ProteomicsDBi74572
74573 [Q8TF72-2]

PTM databases

iPTMnetiQ8TF72
PhosphoSitePlusiQ8TF72

Expressioni

Gene expression databases

BgeeiENSG00000138771 Expressed in 179 organ(s), highest expression level in pancreas
CleanExiHS_SHROOM3
GenevisibleiQ8TF72 HS

Organism-specific databases

HPAiHPA047784

Interactioni

Subunit structurei

Interacts with F-actin.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121665, 18 interactors
IntActiQ8TF72, 14 interactors
MINTiQ8TF72
STRINGi9606.ENSP00000296043

Structurei

3D structure databases

ProteinModelPortaliQ8TF72
SMRiQ8TF72
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 110PDZPROSITE-ProRule annotationAdd BLAST86
Domaini928 – 1030ASD1PROSITE-ProRule annotationAdd BLAST103
Domaini1669 – 1957ASD2PROSITE-ProRule annotationAdd BLAST289

Domaini

The ASD1 domain mediates F-actin binding.By similarity
The ASD2 domain is required for apical constriction induction.By similarity

Sequence similaritiesi

Belongs to the shroom family.Curated

Phylogenomic databases

eggNOGiENOG410II86 Eukaryota
ENOG41113GY LUCA
GeneTreeiENSGT00530000063061
HOGENOMiHOG000169233
HOVERGENiHBG108489
InParanoidiQ8TF72
KOiK18625
OMAiSTHSNKP
OrthoDBiEOG091G00F1
PhylomeDBiQ8TF72
TreeFamiTF333370

Family and domain databases

InterProiView protein in InterPro
IPR014800 ASD1_dom
IPR014799 ASD2_dom
IPR001478 PDZ
IPR036034 PDZ_sf
IPR030494 Shrm3
IPR027685 Shroom_fam
PANTHERiPTHR15012 PTHR15012, 1 hit
PTHR15012:SF33 PTHR15012:SF33, 1 hit
PfamiView protein in Pfam
PF08688 ASD1, 1 hit
PF08687 ASD2, 1 hit
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS51306 ASD1, 1 hit
PS51307 ASD2, 1 hit
PS50106 PDZ, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TF72-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMRTTEDFHK PSATLNSNTA TKGRYIYLEA FLEGGAPWGF TLKGGLEHGE
60 70 80 90 100
PLIISKVEEG GKADTLSSKL QAGDEVVHIN EVTLSSSRKE AVSLVKGSYK
110 120 130 140 150
TLRLVVRRDV CTDPGHADTG ASNFVSPEHL TSGPQHRKAA WSGGVKLRLK
160 170 180 190 200
HRRSEPAGRP HSWHTTKSGE KQPDASMMQI SQGMIGPPWH QSYHSSSSTS
210 220 230 240 250
DLSNYDHAYL RRSPDQCSSQ GSMESLEPSG AYPPCHLSPA KSTGSIDQLS
260 270 280 290 300
HFHNKRDSAY SSFSTSSSIL EYPHPGISGR ERSGSMDNTS ARGGLLEGMR
310 320 330 340 350
QADIRYVKTV YDTRRGVSAE YEVNSSALLL QGREARASAN GQGYDKWSNI
360 370 380 390 400
PRGKGVPPPS WSQQCPSSLE TATDNLPPKV GAPLPPARSD SYAAFRHRER
410 420 430 440 450
PSSWSSLDQK RLCRPQANSL GSLKSPFIEE QLHTVLEKSP ENSPPVKPKH
460 470 480 490 500
NYTQKAQPGQ PLLPTSIYPV PSLEPHFAQV PQPSVSSNGM LYPALAKESG
510 520 530 540 550
YIAPQGACNK MATIDENGNQ NGSGRPGFAF CQPLEHDLLS PVEKKPEATA
560 570 580 590 600
KYVPSKVHFC SVPENEEDAS LKRHLTPPQG NSPHSNERKS THSNKPSSHP
610 620 630 640 650
HSLKCPQAQA WQAGEDKRSS RLSEPWEGDF QEDHNANLWR RLEREGLGQS
660 670 680 690 700
LSGNFGKTKS AFSSLQNIPE SLRRHSSLEL GRGTQEGYPG GRPTCAVNTK
710 720 730 740 750
AEDPGRKAAP DLGSHLDRQV SYPRPEGRTG ASASFNSTDP SPEEPPAPSH
760 770 780 790 800
PHTSSLGRRG PGPGSASALQ GFQYGKPHCS VLEKVSKFEQ REQGSQRPSV
810 820 830 840 850
GGSGFGHNYR PHRTVSTSST SGNDFEETKA HIRFSESAEP LGNGEQHFKN
860 870 880 890 900
GELKLEEASR QPCGQQLSGG ASDSGRGPQR PDARLLRSQS TFQLSSEPER
910 920 930 940 950
EPEWRDRPGS PESPLLDAPF SRAYRNSIKD AQSRVLGATS FRRRDLELGA
960 970 980 990 1000
PVASRSWRPR PSSAHVGLRS PEASASASPH TPRERHSVTP AEGDLARPVP
1010 1020 1030 1040 1050
PAARRGARRR LTPEQKKRSY SEPEKMNEVG IVEEAEPAPL GPQRNGMRFP
1060 1070 1080 1090 1100
ESSVADRRRL FERDGKACST LSLSGPELKQ FQQSALADYI QRKTGKRPTS
1110 1120 1130 1140 1150
AAGCSLQEPG PLRERAQSAY LQPGPAALEG SGLASASSLS SLREPSLQPR
1160 1170 1180 1190 1200
REATLLPATV AETQQAPRDR SSSFAGGRRL GERRRGDLLS GANGGTRGTQ
1210 1220 1230 1240 1250
RGDETPREPS SWGARAGKSM SAEDLLERSD VLAGPVHVRS RSSPATADKR
1260 1270 1280 1290 1300
QDVLLGQDSG FGLVKDPCYL AGPGSRSLSC SERGQEEMLP LFHHLTPRWG
1310 1320 1330 1340 1350
GSGCKAIGDS SVPSECPGTL DHQRQASRTP CPRPPLAGTQ GLVTDTRAAP
1360 1370 1380 1390 1400
LTPIGTPLPS AIPSGYCSQD GQTGRQPLPP YTPAMMHRSN GHTLTQPPGP
1410 1420 1430 1440 1450
RGCEGDGPEH GVEEGTRKRV SLPQWPPPSR AKWAHAARED SLPEESSAPD
1460 1470 1480 1490 1500
FANLKHYQKQ QSLPSLCSTS DPDTPLGAPS TPGRISLRIS ESVLRDSPPP
1510 1520 1530 1540 1550
HEDYEDEVFV RDPHPKATSS PTFEPLPPPP PPPPSQETPV YSMDDFPPPP
1560 1570 1580 1590 1600
PHTVCEAQLD SEDPEGPRPS FNKLSKVTIA RERHMPGAAH VVGSQTLASR
1610 1620 1630 1640 1650
LQTSIKGSEA ESTPPSFMSV HAQLAGSLGG QPAPIQTQSL SHDPVSGTQG
1660 1670 1680 1690 1700
LEKKVSPDPQ KSSEDIRTEA LAKEIVHQDK SLADILDPDS RLKTTMDLME
1710 1720 1730 1740 1750
GLFPRDVNLL KENSVKRKAI QRTVSSSGCE GKRNEDKEAV SMLVNCPAYY
1760 1770 1780 1790 1800
SVSAPKAELL NKIKEMPAEV NEEEEQADVN EKKAELIGSL THKLETLQEA
1810 1820 1830 1840 1850
KGSLLTDIKL NNALGEEVEA LISELCKPNE FDKYRMFIGD LDKVVNLLLS
1860 1870 1880 1890 1900
LSGRLARVEN VLSGLGEDAS NEERSSLYEK RKILAGQHED ARELKENLDR
1910 1920 1930 1940 1950
RERVVLGILA NYLSEEQLQD YQHFVKMKST LLIEQRKLDD KIKLGQEQVK
1960 1970 1980 1990
CLLESLPSDF IPKAGALALP PNLTSEPIPA GGCTFSGIFP TLTSPL
Length:1,996
Mass (Da):216,857
Last modified:July 13, 2010 - v2
Checksum:i735F6CD20FF64BC6
GO
Isoform 2 (identifier: Q8TF72-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-125: Missing.
     126-153: SPEHLTSGPQHRKAAWSGGVKLRLKHRR → MAFYSTPEYDIQLARGLLSGMFLFATRR
     277-311: ISGRERSGSMDNTSARGGLLEGMRQADIRYVKTVY → KRVKTRDLPGSQSPGRAISRKTTMPTSGGGWREKA
     312-1996: Missing.

Show »
Length:186
Mass (Da):20,457
Checksum:i5A9561BA6C6EF074
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y5P9A0A2R8Y5P9_HUMAN
Protein Shroom3
SHROOM3
1,915Annotation score:
A0A2R8Y7T7A0A2R8Y7T7_HUMAN
Protein Shroom3
SHROOM3
50Annotation score:

Sequence cautioni

The sequence AAQ13515 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB84689 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti153R → S in BAB84689 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032062147L → H. Corresponds to variant dbSNP:rs3821979Ensembl.1
Natural variantiVAR_032063279G → A1 PublicationCorresponds to variant dbSNP:rs344140EnsemblClinVar.1
Natural variantiVAR_032064469P → A1 PublicationCorresponds to variant dbSNP:rs344141EnsemblClinVar.1
Natural variantiVAR_0320651290P → L2 PublicationsCorresponds to variant dbSNP:rs3733242Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0249651 – 125Missing in isoform 2. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_024966126 – 153SPEHL…LKHRR → MAFYSTPEYDIQLARGLLSG MFLFATRR in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_024967277 – 311ISGRE…VKTVY → KRVKTRDLPGSQSPGRAISR KTTMPTSGGGWREKA in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_024968312 – 1996Missing in isoform 2. 1 PublicationAdd BLAST1685

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB055660 mRNA Translation: BAB84689.1 Different initiation.
AK127929 mRNA Translation: BAC87195.1
AC096743 Genomic DNA No translation available.
AC107051 Genomic DNA No translation available.
AC107072 Genomic DNA No translation available.
AC112249 Genomic DNA No translation available.
AC121158 Genomic DNA No translation available.
AB040914 mRNA Translation: BAA96005.1
BC007291 mRNA Translation: AAH07291.1
AF109367 mRNA Translation: AAQ13515.1 Different initiation.
CCDSiCCDS3579.2 [Q8TF72-1]
RefSeqiNP_065910.3, NM_020859.3 [Q8TF72-1]
UniGeneiHs.683808
Hs.702168

Genome annotation databases

EnsembliENST00000296043; ENSP00000296043; ENSG00000138771 [Q8TF72-1]
GeneIDi57619
KEGGihsa:57619
UCSCiuc011cbx.3 human [Q8TF72-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB055660 mRNA Translation: BAB84689.1 Different initiation.
AK127929 mRNA Translation: BAC87195.1
AC096743 Genomic DNA No translation available.
AC107051 Genomic DNA No translation available.
AC107072 Genomic DNA No translation available.
AC112249 Genomic DNA No translation available.
AC121158 Genomic DNA No translation available.
AB040914 mRNA Translation: BAA96005.1
BC007291 mRNA Translation: AAH07291.1
AF109367 mRNA Translation: AAQ13515.1 Different initiation.
CCDSiCCDS3579.2 [Q8TF72-1]
RefSeqiNP_065910.3, NM_020859.3 [Q8TF72-1]
UniGeneiHs.683808
Hs.702168

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6FBBX-ray1.30P1240-1244[»]
6FCPX-ray1.45P1233-1247[»]
ProteinModelPortaliQ8TF72
SMRiQ8TF72
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121665, 18 interactors
IntActiQ8TF72, 14 interactors
MINTiQ8TF72
STRINGi9606.ENSP00000296043

PTM databases

iPTMnetiQ8TF72
PhosphoSitePlusiQ8TF72

Polymorphism and mutation databases

BioMutaiSHROOM3
DMDMi300669666

Proteomic databases

EPDiQ8TF72
MaxQBiQ8TF72
PaxDbiQ8TF72
PeptideAtlasiQ8TF72
PRIDEiQ8TF72
ProteomicsDBi74572
74573 [Q8TF72-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296043; ENSP00000296043; ENSG00000138771 [Q8TF72-1]
GeneIDi57619
KEGGihsa:57619
UCSCiuc011cbx.3 human [Q8TF72-1]

Organism-specific databases

CTDi57619
DisGeNETi57619
EuPathDBiHostDB:ENSG00000138771.14
GeneCardsiSHROOM3
H-InvDBiHIX0004309
HIX0163999
HGNCiHGNC:30422 SHROOM3
HPAiHPA047784
MIMi604570 gene
neXtProtiNX_Q8TF72
OpenTargetsiENSG00000138771
PharmGKBiPA147357295
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410II86 Eukaryota
ENOG41113GY LUCA
GeneTreeiENSGT00530000063061
HOGENOMiHOG000169233
HOVERGENiHBG108489
InParanoidiQ8TF72
KOiK18625
OMAiSTHSNKP
OrthoDBiEOG091G00F1
PhylomeDBiQ8TF72
TreeFamiTF333370

Miscellaneous databases

ChiTaRSiSHROOM3 human
GeneWikiiSHROOM3
GenomeRNAii57619
PROiPR:Q8TF72
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138771 Expressed in 179 organ(s), highest expression level in pancreas
CleanExiHS_SHROOM3
GenevisibleiQ8TF72 HS

Family and domain databases

InterProiView protein in InterPro
IPR014800 ASD1_dom
IPR014799 ASD2_dom
IPR001478 PDZ
IPR036034 PDZ_sf
IPR030494 Shrm3
IPR027685 Shroom_fam
PANTHERiPTHR15012 PTHR15012, 1 hit
PTHR15012:SF33 PTHR15012:SF33, 1 hit
PfamiView protein in Pfam
PF08688 ASD1, 1 hit
PF08687 ASD2, 1 hit
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS51306 ASD1, 1 hit
PS51307 ASD2, 1 hit
PS50106 PDZ, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSHRM3_HUMAN
AccessioniPrimary (citable) accession number: Q8TF72
Secondary accession number(s): Q5QTQ3
, Q6ZRW3, Q96IR9, Q9P247
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: July 13, 2010
Last modified: November 7, 2018
This is version 128 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again