Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (16 Oct 2019)
Sequence version 2 (13 Jul 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein Shroom3

Gene

SHROOM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Controls cell shape changes in the neuroepithelium during neural tube closure. Induces apical constriction in epithelial cells by promoting the apical accumulation of F-actin and myosin II, and probably by bundling stress fibers (By similarity). Induces apicobasal cell elongation by redistributing gamma-tubulin and directing the assembly of robust apicobasal microtubule arrays (By similarity).By similarity

Caution

It is uncertain whether Met-1 or Met-2 is the initiator. Met-2 is more conserved than Met-1 among the orthologs.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Developmental protein
Biological processCell shape

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein Shroom3
Alternative name(s):
Shroom-related protein
Short name:
hShrmL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SHROOM3
Synonyms:KIAA1481, SHRML
ORF Names:MSTP013
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30422 SHROOM3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604570 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TF72

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57619

Open Targets

More...
OpenTargetsi
ENSG00000138771

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA147357295

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TF72

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SHROOM3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
300669666

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002860661 – 1996Protein Shroom3Add BLAST1996

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei213PhosphoserineBy similarity1
Modified residuei439PhosphoserineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei816PhosphoserineCombined sources1
Modified residuei890PhosphoserineCombined sources1
Modified residuei910PhosphoserineCombined sources1
Modified residuei913PhosphoserineCombined sources1
Modified residuei970PhosphoserineCombined sources1
Modified residuei1069PhosphoserineBy similarity1
Modified residuei1072PhosphoserineBy similarity1
Modified residuei1221PhosphoserineCombined sources1
Modified residuei1441PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TF72

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TF72

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TF72

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TF72

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TF72

PeptideAtlas

More...
PeptideAtlasi
Q8TF72

PRoteomics IDEntifications database

More...
PRIDEi
Q8TF72

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74572 [Q8TF72-1]
74573 [Q8TF72-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TF72

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TF72

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8TF72

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138771 Expressed in 179 organ(s), highest expression level in pancreas

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TF72 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TF72 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047784

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with F-actin (By similarity).

Interacts with ROCK1 (PubMed:22493320).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121665, 21 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TF72, 20 interactors

Molecular INTeraction database

More...
MINTi
Q8TF72

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000296043

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TF72

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 110PDZPROSITE-ProRule annotationAdd BLAST86
Domaini928 – 1030ASD1PROSITE-ProRule annotationAdd BLAST103
Domaini1669 – 1957ASD2PROSITE-ProRule annotationAdd BLAST289

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The ASD1 domain mediates F-actin binding.By similarity
The ASD2 domain mediates the interaction with ROCK1 and is required for apical constriction induction.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the shroom family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410II86 Eukaryota
ENOG41113GY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157778

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000169233

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TF72

KEGG Orthology (KO)

More...
KOi
K18625

Identification of Orthologs from Complete Genome Data

More...
OMAi
TSGPQHR

Database of Orthologous Groups

More...
OrthoDBi
29607at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TF72

TreeFam database of animal gene trees

More...
TreeFami
TF333370

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR014800 ASD1_dom
IPR014799 ASD2_dom
IPR001478 PDZ
IPR036034 PDZ_sf
IPR030494 Shrm3
IPR027685 Shroom_fam

The PANTHER Classification System

More...
PANTHERi
PTHR15012 PTHR15012, 1 hit
PTHR15012:SF33 PTHR15012:SF33, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08688 ASD1, 1 hit
PF08687 ASD2, 1 hit
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51306 ASD1, 1 hit
PS51307 ASD2, 1 hit
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TF72-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMRTTEDFHK PSATLNSNTA TKGRYIYLEA FLEGGAPWGF TLKGGLEHGE
60 70 80 90 100
PLIISKVEEG GKADTLSSKL QAGDEVVHIN EVTLSSSRKE AVSLVKGSYK
110 120 130 140 150
TLRLVVRRDV CTDPGHADTG ASNFVSPEHL TSGPQHRKAA WSGGVKLRLK
160 170 180 190 200
HRRSEPAGRP HSWHTTKSGE KQPDASMMQI SQGMIGPPWH QSYHSSSSTS
210 220 230 240 250
DLSNYDHAYL RRSPDQCSSQ GSMESLEPSG AYPPCHLSPA KSTGSIDQLS
260 270 280 290 300
HFHNKRDSAY SSFSTSSSIL EYPHPGISGR ERSGSMDNTS ARGGLLEGMR
310 320 330 340 350
QADIRYVKTV YDTRRGVSAE YEVNSSALLL QGREARASAN GQGYDKWSNI
360 370 380 390 400
PRGKGVPPPS WSQQCPSSLE TATDNLPPKV GAPLPPARSD SYAAFRHRER
410 420 430 440 450
PSSWSSLDQK RLCRPQANSL GSLKSPFIEE QLHTVLEKSP ENSPPVKPKH
460 470 480 490 500
NYTQKAQPGQ PLLPTSIYPV PSLEPHFAQV PQPSVSSNGM LYPALAKESG
510 520 530 540 550
YIAPQGACNK MATIDENGNQ NGSGRPGFAF CQPLEHDLLS PVEKKPEATA
560 570 580 590 600
KYVPSKVHFC SVPENEEDAS LKRHLTPPQG NSPHSNERKS THSNKPSSHP
610 620 630 640 650
HSLKCPQAQA WQAGEDKRSS RLSEPWEGDF QEDHNANLWR RLEREGLGQS
660 670 680 690 700
LSGNFGKTKS AFSSLQNIPE SLRRHSSLEL GRGTQEGYPG GRPTCAVNTK
710 720 730 740 750
AEDPGRKAAP DLGSHLDRQV SYPRPEGRTG ASASFNSTDP SPEEPPAPSH
760 770 780 790 800
PHTSSLGRRG PGPGSASALQ GFQYGKPHCS VLEKVSKFEQ REQGSQRPSV
810 820 830 840 850
GGSGFGHNYR PHRTVSTSST SGNDFEETKA HIRFSESAEP LGNGEQHFKN
860 870 880 890 900
GELKLEEASR QPCGQQLSGG ASDSGRGPQR PDARLLRSQS TFQLSSEPER
910 920 930 940 950
EPEWRDRPGS PESPLLDAPF SRAYRNSIKD AQSRVLGATS FRRRDLELGA
960 970 980 990 1000
PVASRSWRPR PSSAHVGLRS PEASASASPH TPRERHSVTP AEGDLARPVP
1010 1020 1030 1040 1050
PAARRGARRR LTPEQKKRSY SEPEKMNEVG IVEEAEPAPL GPQRNGMRFP
1060 1070 1080 1090 1100
ESSVADRRRL FERDGKACST LSLSGPELKQ FQQSALADYI QRKTGKRPTS
1110 1120 1130 1140 1150
AAGCSLQEPG PLRERAQSAY LQPGPAALEG SGLASASSLS SLREPSLQPR
1160 1170 1180 1190 1200
REATLLPATV AETQQAPRDR SSSFAGGRRL GERRRGDLLS GANGGTRGTQ
1210 1220 1230 1240 1250
RGDETPREPS SWGARAGKSM SAEDLLERSD VLAGPVHVRS RSSPATADKR
1260 1270 1280 1290 1300
QDVLLGQDSG FGLVKDPCYL AGPGSRSLSC SERGQEEMLP LFHHLTPRWG
1310 1320 1330 1340 1350
GSGCKAIGDS SVPSECPGTL DHQRQASRTP CPRPPLAGTQ GLVTDTRAAP
1360 1370 1380 1390 1400
LTPIGTPLPS AIPSGYCSQD GQTGRQPLPP YTPAMMHRSN GHTLTQPPGP
1410 1420 1430 1440 1450
RGCEGDGPEH GVEEGTRKRV SLPQWPPPSR AKWAHAARED SLPEESSAPD
1460 1470 1480 1490 1500
FANLKHYQKQ QSLPSLCSTS DPDTPLGAPS TPGRISLRIS ESVLRDSPPP
1510 1520 1530 1540 1550
HEDYEDEVFV RDPHPKATSS PTFEPLPPPP PPPPSQETPV YSMDDFPPPP
1560 1570 1580 1590 1600
PHTVCEAQLD SEDPEGPRPS FNKLSKVTIA RERHMPGAAH VVGSQTLASR
1610 1620 1630 1640 1650
LQTSIKGSEA ESTPPSFMSV HAQLAGSLGG QPAPIQTQSL SHDPVSGTQG
1660 1670 1680 1690 1700
LEKKVSPDPQ KSSEDIRTEA LAKEIVHQDK SLADILDPDS RLKTTMDLME
1710 1720 1730 1740 1750
GLFPRDVNLL KENSVKRKAI QRTVSSSGCE GKRNEDKEAV SMLVNCPAYY
1760 1770 1780 1790 1800
SVSAPKAELL NKIKEMPAEV NEEEEQADVN EKKAELIGSL THKLETLQEA
1810 1820 1830 1840 1850
KGSLLTDIKL NNALGEEVEA LISELCKPNE FDKYRMFIGD LDKVVNLLLS
1860 1870 1880 1890 1900
LSGRLARVEN VLSGLGEDAS NEERSSLYEK RKILAGQHED ARELKENLDR
1910 1920 1930 1940 1950
RERVVLGILA NYLSEEQLQD YQHFVKMKST LLIEQRKLDD KIKLGQEQVK
1960 1970 1980 1990
CLLESLPSDF IPKAGALALP PNLTSEPIPA GGCTFSGIFP TLTSPL
Length:1,996
Mass (Da):216,857
Last modified:July 13, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i735F6CD20FF64BC6
GO
Isoform 2 (identifier: Q8TF72-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-125: Missing.
     126-153: SPEHLTSGPQHRKAAWSGGVKLRLKHRR → MAFYSTPEYDIQLARGLLSGMFLFATRR
     277-311: ISGRERSGSMDNTSARGGLLEGMRQADIRYVKTVY → KRVKTRDLPGSQSPGRAISRKTTMPTSGGGWREKA
     312-1996: Missing.

Show »
Length:186
Mass (Da):20,457
Checksum:i5A9561BA6C6EF074
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y5P9A0A2R8Y5P9_HUMAN
Protein Shroom3
SHROOM3
1,915Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7T7A0A2R8Y7T7_HUMAN
Protein Shroom3
SHROOM3
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ13515 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB84689 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti153R → S in BAB84689 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032062147L → H. Corresponds to variant dbSNP:rs3821979Ensembl.1
Natural variantiVAR_032063279G → A1 PublicationCorresponds to variant dbSNP:rs344140EnsemblClinVar.1
Natural variantiVAR_032064469P → A1 PublicationCorresponds to variant dbSNP:rs344141EnsemblClinVar.1
Natural variantiVAR_0320651290P → L2 PublicationsCorresponds to variant dbSNP:rs3733242Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0249651 – 125Missing in isoform 2. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_024966126 – 153SPEHL…LKHRR → MAFYSTPEYDIQLARGLLSG MFLFATRR in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_024967277 – 311ISGRE…VKTVY → KRVKTRDLPGSQSPGRAISR KTTMPTSGGGWREKA in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_024968312 – 1996Missing in isoform 2. 1 PublicationAdd BLAST1685

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB055660 mRNA Translation: BAB84689.1 Different initiation.
AK127929 mRNA Translation: BAC87195.1
AC096743 Genomic DNA No translation available.
AC107051 Genomic DNA No translation available.
AC107072 Genomic DNA No translation available.
AC112249 Genomic DNA No translation available.
AC121158 Genomic DNA No translation available.
AB040914 mRNA Translation: BAA96005.1
BC007291 mRNA Translation: AAH07291.1
AF109367 mRNA Translation: AAQ13515.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3579.2 [Q8TF72-1]

NCBI Reference Sequences

More...
RefSeqi
NP_065910.3, NM_020859.3 [Q8TF72-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296043; ENSP00000296043; ENSG00000138771 [Q8TF72-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57619

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57619

UCSC genome browser

More...
UCSCi
uc011cbx.3 human [Q8TF72-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB055660 mRNA Translation: BAB84689.1 Different initiation.
AK127929 mRNA Translation: BAC87195.1
AC096743 Genomic DNA No translation available.
AC107051 Genomic DNA No translation available.
AC107072 Genomic DNA No translation available.
AC112249 Genomic DNA No translation available.
AC121158 Genomic DNA No translation available.
AB040914 mRNA Translation: BAA96005.1
BC007291 mRNA Translation: AAH07291.1
AF109367 mRNA Translation: AAQ13515.1 Different initiation.
CCDSiCCDS3579.2 [Q8TF72-1]
RefSeqiNP_065910.3, NM_020859.3 [Q8TF72-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6FBBX-ray1.30P1240-1244[»]
6FCPX-ray1.45P1233-1247[»]
SMRiQ8TF72
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi121665, 21 interactors
IntActiQ8TF72, 20 interactors
MINTiQ8TF72
STRINGi9606.ENSP00000296043

PTM databases

iPTMnetiQ8TF72
PhosphoSitePlusiQ8TF72
SwissPalmiQ8TF72

Polymorphism and mutation databases

BioMutaiSHROOM3
DMDMi300669666

Proteomic databases

EPDiQ8TF72
jPOSTiQ8TF72
MassIVEiQ8TF72
MaxQBiQ8TF72
PaxDbiQ8TF72
PeptideAtlasiQ8TF72
PRIDEiQ8TF72
ProteomicsDBi74572 [Q8TF72-1]
74573 [Q8TF72-2]

Genome annotation databases

EnsembliENST00000296043; ENSP00000296043; ENSG00000138771 [Q8TF72-1]
GeneIDi57619
KEGGihsa:57619
UCSCiuc011cbx.3 human [Q8TF72-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57619
DisGeNETi57619

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SHROOM3
HGNCiHGNC:30422 SHROOM3
HPAiHPA047784
MIMi604570 gene
neXtProtiNX_Q8TF72
OpenTargetsiENSG00000138771
PharmGKBiPA147357295

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410II86 Eukaryota
ENOG41113GY LUCA
GeneTreeiENSGT00940000157778
HOGENOMiHOG000169233
InParanoidiQ8TF72
KOiK18625
OMAiTSGPQHR
OrthoDBi29607at2759
PhylomeDBiQ8TF72
TreeFamiTF333370

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SHROOM3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SHROOM3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57619
PharosiQ8TF72

Protein Ontology

More...
PROi
PR:Q8TF72

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138771 Expressed in 179 organ(s), highest expression level in pancreas
ExpressionAtlasiQ8TF72 baseline and differential
GenevisibleiQ8TF72 HS

Family and domain databases

InterProiView protein in InterPro
IPR014800 ASD1_dom
IPR014799 ASD2_dom
IPR001478 PDZ
IPR036034 PDZ_sf
IPR030494 Shrm3
IPR027685 Shroom_fam
PANTHERiPTHR15012 PTHR15012, 1 hit
PTHR15012:SF33 PTHR15012:SF33, 1 hit
PfamiView protein in Pfam
PF08688 ASD1, 1 hit
PF08687 ASD2, 1 hit
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS51306 ASD1, 1 hit
PS51307 ASD2, 1 hit
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSHRM3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TF72
Secondary accession number(s): Q5QTQ3
, Q6ZRW3, Q96IR9, Q9P247
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: July 13, 2010
Last modified: October 16, 2019
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again