Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sushi, nidogen and EGF-like domain-containing protein 1

Gene

SNED1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandCalcium

Names & Taxonomyi

Protein namesi
Recommended name:
Sushi, nidogen and EGF-like domain-containing protein 1
Alternative name(s):
Insulin-responsive sequence DNA-binding protein 1
Short name:
IRE-BP1
Gene namesi
Name:SNED1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000162804.13
HGNCiHGNC:24696 SNED1
MIMi616634 gene
neXtProtiNX_Q8TER0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi25992
OpenTargetsiENSG00000162804
PharmGKBiPA134946370

Polymorphism and mutation databases

BioMutaiSNED1
DMDMi158563933

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000029955425 – 1413Sushi, nidogen and EGF-like domain-containing protein 1Add BLAST1389

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi145N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi272 ↔ 284By similarity
Disulfide bondi278 ↔ 297By similarity
Disulfide bondi299 ↔ 308By similarity
Disulfide bondi315 ↔ 326By similarity
Disulfide bondi320 ↔ 335By similarity
Disulfide bondi337 ↔ 346By similarity
Disulfide bondi353 ↔ 364By similarity
Disulfide bondi358 ↔ 373By similarity
Disulfide bondi375 ↔ 384By similarity
Disulfide bondi391 ↔ 402By similarity
Disulfide bondi396 ↔ 411By similarity
Glycosylationi408N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi413 ↔ 422By similarity
Disulfide bondi433 ↔ 444By similarity
Disulfide bondi438 ↔ 453By similarity
Disulfide bondi455 ↔ 464By similarity
Disulfide bondi472 ↔ 480By similarity
Disulfide bondi474 ↔ 488By similarity
Disulfide bondi490 ↔ 499By similarity
Disulfide bondi545 ↔ 556By similarity
Disulfide bondi550 ↔ 565By similarity
Disulfide bondi567 ↔ 576By similarity
Disulfide bondi584 ↔ 595By similarity
Disulfide bondi589 ↔ 604By similarity
Disulfide bondi606 ↔ 615By similarity
Disulfide bondi623 ↔ 634By similarity
Disulfide bondi628 ↔ 643By similarity
Disulfide bondi645 ↔ 654By similarity
Disulfide bondi661 ↔ 672By similarity
Disulfide bondi666 ↔ 681By similarity
Disulfide bondi683 ↔ 692By similarity
Disulfide bondi698 ↔ 739By similarity
Disulfide bondi724 ↔ 751By similarity
Disulfide bondi757 ↔ 768By similarity
Disulfide bondi762 ↔ 777By similarity
Disulfide bondi779 ↔ 788By similarity
Disulfide bondi795 ↔ 806By similarity
Disulfide bondi800 ↔ 815By similarity
Disulfide bondi817 ↔ 826By similarity
Disulfide bondi833 ↔ 844By similarity
Disulfide bondi838 ↔ 853By similarity
Disulfide bondi855 ↔ 864By similarity
Disulfide bondi871 ↔ 882By similarity
Disulfide bondi876 ↔ 891By similarity
Disulfide bondi893 ↔ 902By similarity
Glycosylationi977N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1311 ↔ 1322By similarity
Disulfide bondi1316 ↔ 1331By similarity
Disulfide bondi1333 ↔ 1342By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8TER0
PeptideAtlasiQ8TER0
PRIDEiQ8TER0
ProteomicsDBi74481
74482 [Q8TER0-3]
74483 [Q8TER0-4]
74484 [Q8TER0-5]

PTM databases

iPTMnetiQ8TER0
PhosphoSitePlusiQ8TER0

Expressioni

Gene expression databases

BgeeiENSG00000162804
CleanExiHS_SNED1
ExpressionAtlasiQ8TER0 baseline and differential
GenevisibleiQ8TER0 HS

Organism-specific databases

HPAiHPA036414
HPA036415

Interactioni

Protein-protein interaction databases

IntActiQ8TER0, 1 interactor
STRINGi9606.ENSP00000308893

Structurei

3D structure databases

ProteinModelPortaliQ8TER0
SMRiQ8TER0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini103 – 258NIDOPROSITE-ProRule annotationAdd BLAST156
Domaini268 – 309EGF-like 1PROSITE-ProRule annotationAdd BLAST42
Domaini311 – 347EGF-like 2PROSITE-ProRule annotationAdd BLAST37
Domaini349 – 385EGF-like 3PROSITE-ProRule annotationAdd BLAST37
Domaini352 – 374Follistatin-like 1Add BLAST23
Domaini387 – 423EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini429 – 465EGF-like 5PROSITE-ProRule annotationAdd BLAST37
Domaini468 – 500EGF-like 6PROSITE-ProRule annotationAdd BLAST33
Domaini507 – 530Follistatin-like 2Add BLAST24
Domaini541 – 577EGF-like 7PROSITE-ProRule annotationAdd BLAST37
Domaini580 – 616EGF-like 8PROSITE-ProRule annotationAdd BLAST37
Domaini619 – 655EGF-like 9PROSITE-ProRule annotationAdd BLAST37
Domaini657 – 693EGF-like 10PROSITE-ProRule annotationAdd BLAST37
Domaini696 – 753SushiPROSITE-ProRule annotationAdd BLAST58
Domaini753 – 789EGF-like 11; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini791 – 827EGF-like 12; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini829 – 865EGF-like 13PROSITE-ProRule annotationAdd BLAST37
Domaini867 – 903EGF-like 14PROSITE-ProRule annotationAdd BLAST37
Domaini908 – 1006Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST99
Domaini1007 – 1105Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST99
Domaini1106 – 1200Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST95
Domaini1307 – 1343EGF-like 15PROSITE-ProRule annotationAdd BLAST37

Keywords - Domaini

EGF-like domain, Repeat, Signal, Sushi

Phylogenomic databases

eggNOGiKOG1217 Eukaryota
KOG4291 Eukaryota
ENOG410ZK2K LUCA
GeneTreeiENSGT00810000125346
HOVERGENiHBG108495
InParanoidiQ8TER0
OrthoDBiEOG091G002A
PhylomeDBiQ8TER0
TreeFamiTF335195

Family and domain databases

CDDicd00033 CCP, 1 hit
cd00063 FN3, 3 hits
Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR003886 NIDO_dom
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom
PfamiView protein in Pfam
PF00008 EGF, 11 hits
PF00041 fn3, 3 hits
PF12661 hEGF, 3 hits
PF06119 NIDO, 1 hit
SMARTiView protein in SMART
SM00032 CCP, 1 hit
SM00181 EGF, 15 hits
SM00179 EGF_CA, 14 hits
SM00060 FN3, 3 hits
SM00539 NIDO, 1 hit
SUPFAMiSSF49265 SSF49265, 2 hits
SSF57535 SSF57535, 1 hit
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 5 hits
PS00022 EGF_1, 15 hits
PS01186 EGF_2, 13 hits
PS50026 EGF_3, 15 hits
PS01187 EGF_CA, 3 hits
PS50853 FN3, 3 hits
PS51220 NIDO, 1 hit
PS50923 SUSHI, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TER0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRHGVAWALL VAAALGLGAR GVRGAVALAD FYPFGAERGD AVTPKQDDGG
60 70 80 90 100
SGLRPLSVPF PFFGAEHSGL YVNNNGIISF LKEVSQFTPV AFPIAKDRCV
110 120 130 140 150
VAAFWADVDN RRAGDVYYRE ATDPAMLRRA TEDVRHYFPE LLDFNATWVF
160 170 180 190 200
VATWYRVTFF GGSSSSPVNT FQTVLITDGK LSFTIFNYES IVWTTGTHAS
210 220 230 240 250
SGGNATGLGG IAAQAGFNAG DGQRYFSIPG SRTADMAEVE TTTNVGVPGR
260 270 280 290 300
WAFRIDDAQV RVGGCGHTTS VCLALRPCLN GGKCIDDCVT GNPSYTCSCL
310 320 330 340 350
SGFTGRRCHL DVNECASQPC QNGGTCTHGI NSFRCQCPAG FGGPTCETAQ
360 370 380 390 400
SPCDTKECQH GGQCQVENGS AVCVCQAGYT GAACEMDVDD CSPDPCLNGG
410 420 430 440 450
SCVDLVGNYT CLCAEPFKGL RCETGDHPVP DACLSAPCHN GGTCVDADQG
460 470 480 490 500
YVCECPEGFM GLDCRERVPD DCECRNGGRC LGANTTLCQC PLGFFGLLCE
510 520 530 540 550
FEITAMPCNM NTQCPDGGYC MEHGGSYLCV CHTDHNASHS LPSPCDSDPC
560 570 580 590 600
FNGGSCDAHD DSYTCECPRG FHGKHCEKAR PHLCSSGPCR NGGTCKEAGG
610 620 630 640 650
EYHCSCPYRF TGRHCEIGKP DSCASGPCHN GGTCFHYIGK YKCDCPPGFS
660 670 680 690 700
GRHCEIAPSP CFRSPCVNGG TCEDRDTDFF CHCQAGYMGR RCQAEVDCGP
710 720 730 740 750
PEEVKHATLR FNGTRLGAVA LYACDRGYSL SAPSRIRVCQ PHGVWSEPPQ
760 770 780 790 800
CLEIDECRSQ PCLHGGSCQD RVAGYLCLCS TGYEGAHCEL ERDECRAHPC
810 820 830 840 850
RNGGSCRNLP GAYVCRCPAG FVGVHCETEV DACDSSPCQH GGRCESGGGA
860 870 880 890 900
YLCVCPESFF GYHCETVSDP CFSSPCGGRG YCLASNGSHS CTCKVGYTGE
910 920 930 940 950
DCAKELFPPT ALKMERVEES GVSISWNPPN GPAARQMLDG YAVTYVSSDG
960 970 980 990 1000
SYRRTDFVDR TRSSHQLQAL AAGRAYNISV FSVKRNSNNK NDISRPAVLL
1010 1020 1030 1040 1050
ARTRPRPVEG FEVTNVTAST ISVQWALHRI RHATVSGVRV SIRHPEALRD
1060 1070 1080 1090 1100
QATDVDRSVD RFTFRALLPG KRYTIQLTTL SGLRGEEHPT ESLATAPTHV
1110 1120 1130 1140 1150
WTRPLPPANL TAARVTATSA HVVWDAPTPG SLLEAYVINV TTSQSTKSRY
1160 1170 1180 1190 1200
VPNGKLASYT VRDLLPGRRY QLSVIAVQST ELGPQHSEPA HLYIITSPRD
1210 1220 1230 1240 1250
GADRRWHQGG HHPRVLKNRP PPARLPELRL LNDHSAPETP TQPPRFSELV
1260 1270 1280 1290 1300
DGRGRVSARF GGSPSKAATV RSQPTASAQL ENMEEAPKRV SLALQLPEHG
1310 1320 1330 1340 1350
SKDIGNVPGN CSENPCQNGG TCVPGADAHS CDCGPGFKGR RCELACIKVS
1360 1370 1380 1390 1400
RPCTRLFSET KAFPVWEGGV CHHVYKRVYR VHQDICFKES CESTSLKKTP
1410
NRKQSKSQTL EKS
Length:1,413
Mass (Da):152,204
Last modified:September 11, 2007 - v2
Checksum:i09BC8059234326D9
GO
Isoform 2 (identifier: Q8TER0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
     1375-1402: Missing.

Note: No experimental confirmation available.
Show »
Length:1,352
Mass (Da):145,300
Checksum:iE6063435C0AA1CFD
GO
Isoform 3 (identifier: Q8TER0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
     1398-1398: K → L
     1399-1413: Missing.

Note: No experimental confirmation available.
Show »
Length:1,365
Mass (Da):146,970
Checksum:i346748DD68531BC3
GO
Isoform 4 (identifier: Q8TER0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1306-1324: NVPGNCSENPCQNGGTCVP → SESAALVGTLGLTDCSQGP
     1325-1413: Missing.

Note: No experimental confirmation available.
Show »
Length:1,324
Mass (Da):142,073
Checksum:iAA7A732F74E755D6
GO

Sequence cautioni

The sequence AAH27939 differs from that shown. Intron retention. The N-terminal region arises from intron retention.Curated
The sequence AAQ04558 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti546D → N in AAQ04558 (PubMed:15194686).Curated1
Sequence conflicti653H → Y in AAQ04558 (PubMed:15194686).Curated1
Sequence conflicti719V → A in AAQ04558 (PubMed:15194686).Curated1
Sequence conflicti858S → G in AAQ04558 (PubMed:15194686).Curated1
Sequence conflicti1186 – 1206HSEPA…ADRRW → Q in AAQ04558 (PubMed:15194686).CuratedAdd BLAST21

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0348471228L → P. Corresponds to variant dbSNP:rs17440466Ensembl.1
Natural variantiVAR_0348481289R → Q. Corresponds to variant dbSNP:rs6721345Ensembl.1
Natural variantiVAR_0348491299H → R. Corresponds to variant dbSNP:rs6708120Ensembl.1
Natural variantiVAR_0348501362A → S1 PublicationCorresponds to variant dbSNP:rs2108485Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0277491273 – 1306QPTAS…KDIGN → H in isoform 2 and isoform 3. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_0277501306 – 1324NVPGN…GTCVP → SESAALVGTLGLTDCSQGP in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0277511325 – 1413Missing in isoform 4. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0277521375 – 1402Missing in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0277531398K → L in isoform 3. 1 Publication1
Alternative sequenceiVSP_0277541399 – 1413Missing in isoform 3. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005237 Genomic DNA No translation available.
AC093585 Genomic DNA No translation available.
AC104809 Genomic DNA No translation available.
AK074062 mRNA Translation: BAB84888.1
AK074075 mRNA Translation: BAB84901.1
AF439717 mRNA Translation: AAQ04558.1 Different initiation.
AF439718 mRNA Translation: AAQ04563.1
BC027939 mRNA Translation: AAH27939.1 Sequence problems.
CCDSiCCDS46562.1 [Q8TER0-1]
RefSeqiNP_001073906.1, NM_001080437.1 [Q8TER0-1]
UniGeneiHs.471834

Genome annotation databases

EnsembliENST00000310397; ENSP00000308893; ENSG00000162804 [Q8TER0-1]
ENST00000401884; ENSP00000384871; ENSG00000162804 [Q8TER0-5]
ENST00000405547; ENSP00000386007; ENSG00000162804 [Q8TER0-3]
GeneIDi25992
KEGGihsa:25992
UCSCiuc002wah.2 human [Q8TER0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSNED1_HUMAN
AccessioniPrimary (citable) accession number: Q8TER0
Secondary accession number(s): B5MDC3
, B7WNK6, B7WPM0, Q336F4, Q336F5, Q8N369, Q8TEP7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: June 20, 2018
This is version 132 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health