Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 139 (31 Jul 2019)
Sequence version 2 (11 Sep 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sushi, nidogen and EGF-like domain-containing protein 1

Gene

SNED1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandCalcium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sushi, nidogen and EGF-like domain-containing protein 1
Alternative name(s):
Insulin-responsive sequence DNA-binding protein 1
Short name:
IRE-BP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SNED1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24696 SNED1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616634 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TER0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
25992

Open Targets

More...
OpenTargetsi
ENSG00000162804

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134946370

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SNED1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
158563933

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000029955425 – 1413Sushi, nidogen and EGF-like domain-containing protein 1Add BLAST1389

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi145N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi272 ↔ 284By similarity
Disulfide bondi278 ↔ 297By similarity
Disulfide bondi299 ↔ 308By similarity
Disulfide bondi315 ↔ 326By similarity
Disulfide bondi320 ↔ 335By similarity
Disulfide bondi337 ↔ 346By similarity
Disulfide bondi353 ↔ 364By similarity
Disulfide bondi358 ↔ 373By similarity
Disulfide bondi375 ↔ 384By similarity
Disulfide bondi391 ↔ 402By similarity
Disulfide bondi396 ↔ 411By similarity
Glycosylationi408N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi413 ↔ 422By similarity
Disulfide bondi433 ↔ 444By similarity
Disulfide bondi438 ↔ 453By similarity
Disulfide bondi455 ↔ 464By similarity
Disulfide bondi472 ↔ 480By similarity
Disulfide bondi474 ↔ 488By similarity
Disulfide bondi490 ↔ 499By similarity
Disulfide bondi545 ↔ 556By similarity
Disulfide bondi550 ↔ 565By similarity
Disulfide bondi567 ↔ 576By similarity
Disulfide bondi584 ↔ 595By similarity
Disulfide bondi589 ↔ 604By similarity
Disulfide bondi606 ↔ 615By similarity
Disulfide bondi623 ↔ 634By similarity
Disulfide bondi628 ↔ 643By similarity
Disulfide bondi645 ↔ 654By similarity
Disulfide bondi661 ↔ 672By similarity
Disulfide bondi666 ↔ 681By similarity
Disulfide bondi683 ↔ 692By similarity
Disulfide bondi698 ↔ 739By similarity
Disulfide bondi724 ↔ 751By similarity
Disulfide bondi757 ↔ 768By similarity
Disulfide bondi762 ↔ 777By similarity
Disulfide bondi779 ↔ 788By similarity
Disulfide bondi795 ↔ 806By similarity
Disulfide bondi800 ↔ 815By similarity
Disulfide bondi817 ↔ 826By similarity
Disulfide bondi833 ↔ 844By similarity
Disulfide bondi838 ↔ 853By similarity
Disulfide bondi855 ↔ 864By similarity
Disulfide bondi871 ↔ 882By similarity
Disulfide bondi876 ↔ 891By similarity
Disulfide bondi893 ↔ 902By similarity
Glycosylationi977N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1311 ↔ 1322By similarity
Disulfide bondi1316 ↔ 1331By similarity
Disulfide bondi1333 ↔ 1342By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TER0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TER0

PeptideAtlas

More...
PeptideAtlasi
Q8TER0

PRoteomics IDEntifications database

More...
PRIDEi
Q8TER0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74481 [Q8TER0-1]
74482 [Q8TER0-3]
74483 [Q8TER0-4]
74484 [Q8TER0-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TER0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TER0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162804 Expressed in 180 organ(s), highest expression level in tendon

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TER0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TER0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036414
HPA036415

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q8TER0, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000308893

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TER0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini103 – 258NIDOPROSITE-ProRule annotationAdd BLAST156
Domaini268 – 309EGF-like 1PROSITE-ProRule annotationAdd BLAST42
Domaini311 – 347EGF-like 2PROSITE-ProRule annotationAdd BLAST37
Domaini349 – 385EGF-like 3PROSITE-ProRule annotationAdd BLAST37
Domaini352 – 374Follistatin-like 1Add BLAST23
Domaini387 – 423EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini429 – 465EGF-like 5PROSITE-ProRule annotationAdd BLAST37
Domaini468 – 500EGF-like 6PROSITE-ProRule annotationAdd BLAST33
Domaini507 – 530Follistatin-like 2Add BLAST24
Domaini541 – 577EGF-like 7PROSITE-ProRule annotationAdd BLAST37
Domaini580 – 616EGF-like 8PROSITE-ProRule annotationAdd BLAST37
Domaini619 – 655EGF-like 9PROSITE-ProRule annotationAdd BLAST37
Domaini657 – 693EGF-like 10PROSITE-ProRule annotationAdd BLAST37
Domaini696 – 753SushiPROSITE-ProRule annotationAdd BLAST58
Domaini753 – 789EGF-like 11; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini791 – 827EGF-like 12; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini829 – 865EGF-like 13PROSITE-ProRule annotationAdd BLAST37
Domaini867 – 903EGF-like 14PROSITE-ProRule annotationAdd BLAST37
Domaini908 – 1006Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST99
Domaini1007 – 1105Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST99
Domaini1106 – 1200Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST95
Domaini1307 – 1343EGF-like 15PROSITE-ProRule annotationAdd BLAST37

Keywords - Domaini

EGF-like domain, Repeat, Signal, Sushi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1217 Eukaryota
KOG4291 Eukaryota
ENOG410ZK2K LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160730

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TER0

Database of Orthologous Groups

More...
OrthoDBi
7525at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TER0

TreeFam database of animal gene trees

More...
TreeFami
TF335195

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00033 CCP, 1 hit
cd00063 FN3, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR003886 NIDO_dom
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00008 EGF, 11 hits
PF00041 fn3, 3 hits
PF12661 hEGF, 3 hits
PF06119 NIDO, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00032 CCP, 1 hit
SM00181 EGF, 15 hits
SM00179 EGF_CA, 14 hits
SM00060 FN3, 3 hits
SM00539 NIDO, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265 SSF49265, 2 hits
SSF57535 SSF57535, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 5 hits
PS00022 EGF_1, 15 hits
PS01186 EGF_2, 13 hits
PS50026 EGF_3, 15 hits
PS01187 EGF_CA, 3 hits
PS50853 FN3, 3 hits
PS51220 NIDO, 1 hit
PS50923 SUSHI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TER0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRHGVAWALL VAAALGLGAR GVRGAVALAD FYPFGAERGD AVTPKQDDGG
60 70 80 90 100
SGLRPLSVPF PFFGAEHSGL YVNNNGIISF LKEVSQFTPV AFPIAKDRCV
110 120 130 140 150
VAAFWADVDN RRAGDVYYRE ATDPAMLRRA TEDVRHYFPE LLDFNATWVF
160 170 180 190 200
VATWYRVTFF GGSSSSPVNT FQTVLITDGK LSFTIFNYES IVWTTGTHAS
210 220 230 240 250
SGGNATGLGG IAAQAGFNAG DGQRYFSIPG SRTADMAEVE TTTNVGVPGR
260 270 280 290 300
WAFRIDDAQV RVGGCGHTTS VCLALRPCLN GGKCIDDCVT GNPSYTCSCL
310 320 330 340 350
SGFTGRRCHL DVNECASQPC QNGGTCTHGI NSFRCQCPAG FGGPTCETAQ
360 370 380 390 400
SPCDTKECQH GGQCQVENGS AVCVCQAGYT GAACEMDVDD CSPDPCLNGG
410 420 430 440 450
SCVDLVGNYT CLCAEPFKGL RCETGDHPVP DACLSAPCHN GGTCVDADQG
460 470 480 490 500
YVCECPEGFM GLDCRERVPD DCECRNGGRC LGANTTLCQC PLGFFGLLCE
510 520 530 540 550
FEITAMPCNM NTQCPDGGYC MEHGGSYLCV CHTDHNASHS LPSPCDSDPC
560 570 580 590 600
FNGGSCDAHD DSYTCECPRG FHGKHCEKAR PHLCSSGPCR NGGTCKEAGG
610 620 630 640 650
EYHCSCPYRF TGRHCEIGKP DSCASGPCHN GGTCFHYIGK YKCDCPPGFS
660 670 680 690 700
GRHCEIAPSP CFRSPCVNGG TCEDRDTDFF CHCQAGYMGR RCQAEVDCGP
710 720 730 740 750
PEEVKHATLR FNGTRLGAVA LYACDRGYSL SAPSRIRVCQ PHGVWSEPPQ
760 770 780 790 800
CLEIDECRSQ PCLHGGSCQD RVAGYLCLCS TGYEGAHCEL ERDECRAHPC
810 820 830 840 850
RNGGSCRNLP GAYVCRCPAG FVGVHCETEV DACDSSPCQH GGRCESGGGA
860 870 880 890 900
YLCVCPESFF GYHCETVSDP CFSSPCGGRG YCLASNGSHS CTCKVGYTGE
910 920 930 940 950
DCAKELFPPT ALKMERVEES GVSISWNPPN GPAARQMLDG YAVTYVSSDG
960 970 980 990 1000
SYRRTDFVDR TRSSHQLQAL AAGRAYNISV FSVKRNSNNK NDISRPAVLL
1010 1020 1030 1040 1050
ARTRPRPVEG FEVTNVTAST ISVQWALHRI RHATVSGVRV SIRHPEALRD
1060 1070 1080 1090 1100
QATDVDRSVD RFTFRALLPG KRYTIQLTTL SGLRGEEHPT ESLATAPTHV
1110 1120 1130 1140 1150
WTRPLPPANL TAARVTATSA HVVWDAPTPG SLLEAYVINV TTSQSTKSRY
1160 1170 1180 1190 1200
VPNGKLASYT VRDLLPGRRY QLSVIAVQST ELGPQHSEPA HLYIITSPRD
1210 1220 1230 1240 1250
GADRRWHQGG HHPRVLKNRP PPARLPELRL LNDHSAPETP TQPPRFSELV
1260 1270 1280 1290 1300
DGRGRVSARF GGSPSKAATV RSQPTASAQL ENMEEAPKRV SLALQLPEHG
1310 1320 1330 1340 1350
SKDIGNVPGN CSENPCQNGG TCVPGADAHS CDCGPGFKGR RCELACIKVS
1360 1370 1380 1390 1400
RPCTRLFSET KAFPVWEGGV CHHVYKRVYR VHQDICFKES CESTSLKKTP
1410
NRKQSKSQTL EKS
Length:1,413
Mass (Da):152,204
Last modified:September 11, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i09BC8059234326D9
GO
Isoform 2 (identifier: Q8TER0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
     1375-1402: Missing.

Note: No experimental confirmation available.
Show »
Length:1,352
Mass (Da):145,300
Checksum:iE6063435C0AA1CFD
GO
Isoform 3 (identifier: Q8TER0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
     1398-1398: K → L
     1399-1413: Missing.

Note: No experimental confirmation available.
Show »
Length:1,365
Mass (Da):146,970
Checksum:i346748DD68531BC3
GO
Isoform 4 (identifier: Q8TER0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1306-1324: NVPGNCSENPCQNGGTCVP → SESAALVGTLGLTDCSQGP
     1325-1413: Missing.

Note: No experimental confirmation available.
Show »
Length:1,324
Mass (Da):142,073
Checksum:iAA7A732F74E755D6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MEF5B5MEF5_HUMAN
Sushi, nidogen and EGF-like domain-...
SNED1
599Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1R9H7C1R9_HUMAN
Sushi, nidogen and EGF-like domain-...
SNED1
272Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BYY9H7BYY9_HUMAN
Sushi, nidogen and EGF-like domain-...
SNED1
300Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0D4H7C0D4_HUMAN
Sushi, nidogen and EGF-like domain-...
SNED1
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH27939 differs from that shown. Intron retention. The N-terminal region arises from intron retention.Curated
The sequence AAQ04558 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti546D → N in AAQ04558 (PubMed:15194686).Curated1
Sequence conflicti653H → Y in AAQ04558 (PubMed:15194686).Curated1
Sequence conflicti719V → A in AAQ04558 (PubMed:15194686).Curated1
Sequence conflicti858S → G in AAQ04558 (PubMed:15194686).Curated1
Sequence conflicti1186 – 1206HSEPA…ADRRW → Q in AAQ04558 (PubMed:15194686).CuratedAdd BLAST21

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0348471228L → P. Corresponds to variant dbSNP:rs17440466Ensembl.1
Natural variantiVAR_0348481289R → Q. Corresponds to variant dbSNP:rs6721345Ensembl.1
Natural variantiVAR_0348491299H → R. Corresponds to variant dbSNP:rs6708120Ensembl.1
Natural variantiVAR_0348501362A → S1 PublicationCorresponds to variant dbSNP:rs2108485Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0277491273 – 1306QPTAS…KDIGN → H in isoform 2 and isoform 3. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_0277501306 – 1324NVPGN…GTCVP → SESAALVGTLGLTDCSQGP in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0277511325 – 1413Missing in isoform 4. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0277521375 – 1402Missing in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0277531398K → L in isoform 3. 1 Publication1
Alternative sequenceiVSP_0277541399 – 1413Missing in isoform 3. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC005237 Genomic DNA No translation available.
AC093585 Genomic DNA No translation available.
AC104809 Genomic DNA No translation available.
AK074062 mRNA Translation: BAB84888.1
AK074075 mRNA Translation: BAB84901.1
AF439717 mRNA Translation: AAQ04558.1 Different initiation.
AF439718 mRNA Translation: AAQ04563.1
BC027939 mRNA Translation: AAH27939.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46562.1 [Q8TER0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001073906.1, NM_001080437.1 [Q8TER0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000310397; ENSP00000308893; ENSG00000162804 [Q8TER0-1]
ENST00000401884; ENSP00000384871; ENSG00000162804 [Q8TER0-5]
ENST00000405547; ENSP00000386007; ENSG00000162804 [Q8TER0-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25992

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25992

UCSC genome browser

More...
UCSCi
uc002wah.2 human [Q8TER0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005237 Genomic DNA No translation available.
AC093585 Genomic DNA No translation available.
AC104809 Genomic DNA No translation available.
AK074062 mRNA Translation: BAB84888.1
AK074075 mRNA Translation: BAB84901.1
AF439717 mRNA Translation: AAQ04558.1 Different initiation.
AF439718 mRNA Translation: AAQ04563.1
BC027939 mRNA Translation: AAH27939.1 Sequence problems.
CCDSiCCDS46562.1 [Q8TER0-1]
RefSeqiNP_001073906.1, NM_001080437.1 [Q8TER0-1]

3D structure databases

SMRiQ8TER0
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ8TER0, 1 interactor
STRINGi9606.ENSP00000308893

PTM databases

iPTMnetiQ8TER0
PhosphoSitePlusiQ8TER0

Polymorphism and mutation databases

BioMutaiSNED1
DMDMi158563933

Proteomic databases

jPOSTiQ8TER0
PaxDbiQ8TER0
PeptideAtlasiQ8TER0
PRIDEiQ8TER0
ProteomicsDBi74481 [Q8TER0-1]
74482 [Q8TER0-3]
74483 [Q8TER0-4]
74484 [Q8TER0-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000310397; ENSP00000308893; ENSG00000162804 [Q8TER0-1]
ENST00000401884; ENSP00000384871; ENSG00000162804 [Q8TER0-5]
ENST00000405547; ENSP00000386007; ENSG00000162804 [Q8TER0-3]
GeneIDi25992
KEGGihsa:25992
UCSCiuc002wah.2 human [Q8TER0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25992
DisGeNETi25992

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SNED1
HGNCiHGNC:24696 SNED1
HPAiHPA036414
HPA036415
MIMi616634 gene
neXtProtiNX_Q8TER0
OpenTargetsiENSG00000162804
PharmGKBiPA134946370

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1217 Eukaryota
KOG4291 Eukaryota
ENOG410ZK2K LUCA
GeneTreeiENSGT00940000160730
InParanoidiQ8TER0
OrthoDBi7525at2759
PhylomeDBiQ8TER0
TreeFamiTF335195

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SNED1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25992

Protein Ontology

More...
PROi
PR:Q8TER0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162804 Expressed in 180 organ(s), highest expression level in tendon
ExpressionAtlasiQ8TER0 baseline and differential
GenevisibleiQ8TER0 HS

Family and domain databases

CDDicd00033 CCP, 1 hit
cd00063 FN3, 3 hits
Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR003886 NIDO_dom
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom
PfamiView protein in Pfam
PF00008 EGF, 11 hits
PF00041 fn3, 3 hits
PF12661 hEGF, 3 hits
PF06119 NIDO, 1 hit
SMARTiView protein in SMART
SM00032 CCP, 1 hit
SM00181 EGF, 15 hits
SM00179 EGF_CA, 14 hits
SM00060 FN3, 3 hits
SM00539 NIDO, 1 hit
SUPFAMiSSF49265 SSF49265, 2 hits
SSF57535 SSF57535, 1 hit
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 5 hits
PS00022 EGF_1, 15 hits
PS01186 EGF_2, 13 hits
PS50026 EGF_3, 15 hits
PS01187 EGF_CA, 3 hits
PS50853 FN3, 3 hits
PS51220 NIDO, 1 hit
PS50923 SUSHI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNED1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TER0
Secondary accession number(s): B5MDC3
, B7WNK6, B7WPM0, Q336F4, Q336F5, Q8N369, Q8TEP7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: July 31, 2019
This is version 139 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again