Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8TEQ0 (SNX29_HUMAN)

Entry version 126 (02 Dec 2020)
Sequence version 3 (19 Oct 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Sorting nexin-29

Gene

SNX29

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8TEQ0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sorting nexin-29
Alternative name(s):
RUN domain-containing protein 2A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SNX29
Synonyms:RUNDC2A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000048471.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:30542, SNX29

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8TEQ0

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		92017

Open Targets

More...OpenTargetsi		ENSG00000048471

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162404312

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8TEQ0, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SNX29

Domain mapping of disease mutations (DMDM)

More...DMDMi		353526314

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002975651 – 813Sorting nexin-29Add BLAST813

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei268PhosphoserineCombined sources1
Modified residuei291PhosphoserineBy similarity1
Modified residuei292PhosphoserineBy similarity1
Modified residuei330PhosphoserineCombined sources1
Modified residuei344PhosphoserineBy similarity1
Modified residuei445PhosphoserineBy similarity1
Modified residuei450PhosphoserineBy similarity1
Modified residuei639PhosphoserineBy similarity1
Modified residuei641PhosphothreonineBy similarity1
Modified residuei642PhosphoserineBy similarity1
Modified residuei646PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8TEQ0

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8TEQ0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8TEQ0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8TEQ0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8TEQ0

PeptideAtlas

More...PeptideAtlasi		Q8TEQ0

PRoteomics IDEntifications database

More...PRIDEi		Q8TEQ0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		74476 [Q8TEQ0-1]
74477 [Q8TEQ0-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8TEQ0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8TEQ0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000048471, Expressed in sural nerve and 207 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8TEQ0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8TEQ0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000048471, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124903, 14 interactors

Protein interaction database and analysis system

More...IntActi		Q8TEQ0, 10 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000456480

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8TEQ0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8TEQ0

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini36 – 180RUNPROSITE-ProRule annotationAdd BLAST145
Domaini656 – 779PXPROSITE-ProRule annotationAdd BLAST124

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili466 – 545Sequence analysisAdd BLAST80

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sorting nexin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2101, Eukaryota
KOG4381, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00730000110975

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_020563_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8TEQ0

Identification of Orthologs from Complete Genome Data

More...OMAi		HEQERFS

Database of Orthologous Groups

More...OrthoDBi		543799at2759

Family and domain databases

Conserved Domains Database

More...CDDi		cd07277, PX_RUN, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.58.900, 1 hit
3.30.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001683, PX_dom
IPR036871, PX_dom_sf
IPR004012, Run_dom
IPR037213, Run_dom_sf
IPR037916, SNX29_PX

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00787, PX, 1 hit
PF02759, RUN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00312, PX, 1 hit
SM00593, RUN, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF140741, SSF140741, 1 hit
SSF64268, SSF64268, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50195, PX, 1 hit
PS50826, RUN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TEQ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGSQNNDKR QFLLERLLDA VKQCQIRFGG RKEIASDSDS RVTCLCAQFE 
        60         70         80         90        100
AVLQHGLKRS RGLALTAAAI KQAAGFASKT ETEPVFWYYV KEVLNKHELQ 
       110        120        130        140        150
RFYSLRHIAS DVGRGRAWLR CALNEHSLER YLHMLLADRC RLSTFYEDWS 
       160        170        180        190        200
FVMDEERSSM LPTMAAGLNS ILFAINIDNK DLNGQSKFAP TVSDLLKEST 
       210        220        230        240        250
QNVTSLLKES TQGVSSLFRE ITASSAVSIL IKPEQETDPL PVVSRNVSAD 
       260        270        280        290        300
AKCKKERKKK KKVTNIISFD DEEDEQNSGD VFKKTPGAGE SSEDNSDRSS 
       310        320        330        340        350
VNIMSAFESP FGPNSNGSQS SNSWKIDSLS LNGEFGYQKL DVKSIDDEDV 
       360        370        380        390        400
DENEDDVYGN SSGRKHRGHS ESPEKPLEGN TCLSQMHSWA PLKVLHNDSD 
       410        420        430        440        450
ILFPVSGVGS YSPADAPLGS LENGTGPEDH VLPDPGLRYS VEASSPGHGS 
       460        470        480        490        500
PLSSLLPSAS VPESMTISEL RQATVAMMNR KDELEEENRS LRNLLDGEME 
       510        520        530        540        550
HSAALRQEVD TLKRKVAEQE ERQGMKVQAL ARENEVLKVQ LKKYVGAVQM 
       560        570        580        590        600
LKREGQTAEV PNLWSVDGEV TVAEQKPGEI AEELASSYER KLIEVAEMHG 
       610        620        630        640        650
ELIEFNERLH RALVAKEALV SQMRQELIDL RGPVPGDLSQ TSEDQSLSDF 
       660        670        680        690        700
EISNRALINV WIPSVFLRGK AANAFHVYQV YIRIKDDEWN IYRRYTEFRS 
       710        720        730        740        750
LHHKLQNKYP QVRAYNFPPK KAIGNKDAKF VEERRKQLQN YLRSVMNKVI 
       760        770        780        790        800
QMVPEFAASP KKETLIQLMP FFVDITPPGE PVNSRPKAAS RFPKLSRGQP 
       810 
RETRNVEPQS GDL
Length:813
Mass (Da):91,254
Last modified:October 19, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA1868A682CCFBE0C
GO
Isoform 2 (identifier: Q8TEQ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     775-813: ITPPGEPVNSRPKAASRFPKLSRGQPRETRNVEPQSGDL → WISLFGNGRDSSREEFSSS

Show »
Length:793
Mass (Da):89,144
Checksum:iD6EA31956390331B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGM3A0A0C4DGM3_HUMAN
Sorting nexin-29
SNX29
282Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQF0H3BQF0_HUMAN
Sorting nexin-29
SNX29
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BT98H3BT98_HUMAN
Sorting nexin-29
SNX29
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BPI1H3BPI1_HUMAN
Sorting nexin-29
SNX29
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB14033 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti183N → D in BAB14033 (PubMed:14702039).Curated1
Sequence conflicti344S → G in BAB14033 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027281775 – 813ITPPG…QSGDL → WISLFGNGRDSSREEFSSS in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AC007216 Genomic DNA No translation available.
AC007598 Genomic DNA No translation available.
AC007601 Genomic DNA No translation available.
AC010333 Genomic DNA No translation available.
AC092365 Genomic DNA No translation available.
AC131391 Genomic DNA No translation available.
AK022425 mRNA Translation: BAB14033.1 Sequence problems.
AK074072 mRNA Translation: BAB84898.1
BC029857 mRNA Translation: AAH29857.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10553.2 [Q8TEQ0-1]

NCBI Reference Sequences

More...RefSeqi		NP_115543.3, NM_032167.4 [Q8TEQ0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000566228; ENSP00000456480; ENSG00000048471 [Q8TEQ0-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		92017

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:92017

UCSC genome browser

More...UCSCi		uc002dby.6, human [Q8TEQ0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC007216 Genomic DNA No translation available.
AC007598 Genomic DNA No translation available.
AC007601 Genomic DNA No translation available.
AC010333 Genomic DNA No translation available.
AC092365 Genomic DNA No translation available.
AC131391 Genomic DNA No translation available.
AK022425 mRNA Translation: BAB14033.1 Sequence problems.
AK074072 mRNA Translation: BAB84898.1
BC029857 mRNA Translation: AAH29857.1
CCDSiCCDS10553.2 [Q8TEQ0-1]
RefSeqiNP_115543.3, NM_032167.4 [Q8TEQ0-1]

3D structure databases

SMRiQ8TEQ0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124903, 14 interactors
IntActiQ8TEQ0, 10 interactors
STRINGi9606.ENSP00000456480

PTM databases

iPTMnetiQ8TEQ0
PhosphoSitePlusiQ8TEQ0

Polymorphism and mutation databases

BioMutaiSNX29
DMDMi353526314

Proteomic databases

EPDiQ8TEQ0
jPOSTiQ8TEQ0
MassIVEiQ8TEQ0
MaxQBiQ8TEQ0
PaxDbiQ8TEQ0
PeptideAtlasiQ8TEQ0
PRIDEiQ8TEQ0
ProteomicsDBi74476 [Q8TEQ0-1]
74477 [Q8TEQ0-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2225, 121 antibodies

The DNASU plasmid repository

More...DNASUi		92017

Genome annotation databases

EnsembliENST00000566228; ENSP00000456480; ENSG00000048471 [Q8TEQ0-1]
GeneIDi92017
KEGGihsa:92017
UCSCiuc002dby.6, human [Q8TEQ0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		92017
DisGeNETi92017
EuPathDBiHostDB:ENSG00000048471.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		SNX29
HGNCiHGNC:30542, SNX29
HPAiENSG00000048471, Low tissue specificity
neXtProtiNX_Q8TEQ0
OpenTargetsiENSG00000048471
PharmGKBiPA162404312

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2101, Eukaryota
KOG4381, Eukaryota
GeneTreeiENSGT00730000110975
HOGENOMiCLU_020563_1_0_1
InParanoidiQ8TEQ0
OMAiHEQERFS
OrthoDBi543799at2759

Enzyme and pathway databases

PathwayCommonsiQ8TEQ0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		92017, 4 hits in 840 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SNX29, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		92017
PharosiQ8TEQ0, Tdark

Protein Ontology

More...PROi		PR:Q8TEQ0
RNActiQ8TEQ0, protein

Gene expression databases

BgeeiENSG00000048471, Expressed in sural nerve and 207 other tissues
ExpressionAtlasiQ8TEQ0, baseline and differential
GenevisibleiQ8TEQ0, HS

Family and domain databases

CDDicd07277, PX_RUN, 1 hit
Gene3Di1.20.58.900, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR001683, PX_dom
IPR036871, PX_dom_sf
IPR004012, Run_dom
IPR037213, Run_dom_sf
IPR037916, SNX29_PX
PfamiView protein in Pfam
PF00787, PX, 1 hit
PF02759, RUN, 1 hit
SMARTiView protein in SMART
SM00312, PX, 1 hit
SM00593, RUN, 1 hit
SUPFAMiSSF140741, SSF140741, 1 hit
SSF64268, SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195, PX, 1 hit
PS50826, RUN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNX29_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TEQ0
Secondary accession number(s): B5MDW2, Q8N2X2, Q9HA26
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: October 19, 2011
Last modified: December 2, 2020
This is version 126 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again