Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorting nexin-29

Gene

SNX29

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
Sorting nexin-29
Alternative name(s):
RUN domain-containing protein 2A
Gene namesi
Name:SNX29
Synonyms:RUNDC2A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000048471.13
HGNCiHGNC:30542 SNX29
neXtProtiNX_Q8TEQ0

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000048471
PharmGKBiPA142670962
PA162404312

Polymorphism and mutation databases

BioMutaiSNX29
DMDMi353526314

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002975651 – 813Sorting nexin-29Add BLAST813

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei268PhosphoserineCombined sources1
Modified residuei291PhosphoserineBy similarity1
Modified residuei292PhosphoserineBy similarity1
Modified residuei330PhosphoserineCombined sources1
Modified residuei344PhosphoserineBy similarity1
Modified residuei445PhosphoserineBy similarity1
Modified residuei450PhosphoserineBy similarity1
Modified residuei639PhosphoserineBy similarity1
Modified residuei641PhosphothreonineBy similarity1
Modified residuei642PhosphoserineBy similarity1
Modified residuei646PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TEQ0
MaxQBiQ8TEQ0
PaxDbiQ8TEQ0
PeptideAtlasiQ8TEQ0
PRIDEiQ8TEQ0
ProteomicsDBi74476
74477 [Q8TEQ0-2]

PTM databases

iPTMnetiQ8TEQ0
PhosphoSitePlusiQ8TEQ0

Expressioni

Gene expression databases

BgeeiENSG00000048471 Expressed in 193 organ(s), highest expression level in metanephros
CleanExiHS_RUNDC2A
HS_SNX29
ExpressionAtlasiQ8TEQ0 baseline and differential
GenevisibleiQ8TEQ0 HS

Organism-specific databases

HPAiHPA008889

Interactioni

Protein-protein interaction databases

BioGridi124903, 10 interactors
IntActiQ8TEQ0, 8 interactors

Structurei

3D structure databases

ProteinModelPortaliQ8TEQ0
SMRiQ8TEQ0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 180RUNPROSITE-ProRule annotationAdd BLAST145
Domaini656 – 779PXPROSITE-ProRule annotationAdd BLAST124

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili466 – 545Sequence analysisAdd BLAST80

Sequence similaritiesi

Belongs to the sorting nexin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4381 Eukaryota
ENOG410XRAX LUCA
GeneTreeiENSGT00730000110975
HOGENOMiHOG000154364
HOVERGENiHBG108498
InParanoidiQ8TEQ0
KOiK17935
OMAiHSHVLTW
OrthoDBiEOG091G0696

Family and domain databases

CDDicd07277 PX_RUN, 1 hit
Gene3Di3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR001683 Phox
IPR036871 PX_dom_sf
IPR004012 Run_dom
IPR037213 Run_dom_sf
IPR037916 SNX29_PX
PfamiView protein in Pfam
PF00787 PX, 1 hit
PF02759 RUN, 1 hit
SMARTiView protein in SMART
SM00312 PX, 1 hit
SM00593 RUN, 1 hit
SUPFAMiSSF140741 SSF140741, 1 hit
SSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195 PX, 1 hit
PS50826 RUN, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TEQ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGSQNNDKR QFLLERLLDA VKQCQIRFGG RKEIASDSDS RVTCLCAQFE
60 70 80 90 100
AVLQHGLKRS RGLALTAAAI KQAAGFASKT ETEPVFWYYV KEVLNKHELQ
110 120 130 140 150
RFYSLRHIAS DVGRGRAWLR CALNEHSLER YLHMLLADRC RLSTFYEDWS
160 170 180 190 200
FVMDEERSSM LPTMAAGLNS ILFAINIDNK DLNGQSKFAP TVSDLLKEST
210 220 230 240 250
QNVTSLLKES TQGVSSLFRE ITASSAVSIL IKPEQETDPL PVVSRNVSAD
260 270 280 290 300
AKCKKERKKK KKVTNIISFD DEEDEQNSGD VFKKTPGAGE SSEDNSDRSS
310 320 330 340 350
VNIMSAFESP FGPNSNGSQS SNSWKIDSLS LNGEFGYQKL DVKSIDDEDV
360 370 380 390 400
DENEDDVYGN SSGRKHRGHS ESPEKPLEGN TCLSQMHSWA PLKVLHNDSD
410 420 430 440 450
ILFPVSGVGS YSPADAPLGS LENGTGPEDH VLPDPGLRYS VEASSPGHGS
460 470 480 490 500
PLSSLLPSAS VPESMTISEL RQATVAMMNR KDELEEENRS LRNLLDGEME
510 520 530 540 550
HSAALRQEVD TLKRKVAEQE ERQGMKVQAL ARENEVLKVQ LKKYVGAVQM
560 570 580 590 600
LKREGQTAEV PNLWSVDGEV TVAEQKPGEI AEELASSYER KLIEVAEMHG
610 620 630 640 650
ELIEFNERLH RALVAKEALV SQMRQELIDL RGPVPGDLSQ TSEDQSLSDF
660 670 680 690 700
EISNRALINV WIPSVFLRGK AANAFHVYQV YIRIKDDEWN IYRRYTEFRS
710 720 730 740 750
LHHKLQNKYP QVRAYNFPPK KAIGNKDAKF VEERRKQLQN YLRSVMNKVI
760 770 780 790 800
QMVPEFAASP KKETLIQLMP FFVDITPPGE PVNSRPKAAS RFPKLSRGQP
810
RETRNVEPQS GDL
Length:813
Mass (Da):91,254
Last modified:October 19, 2011 - v3
Checksum:iA1868A682CCFBE0C
GO
Isoform 2 (identifier: Q8TEQ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     775-813: ITPPGEPVNSRPKAASRFPKLSRGQPRETRNVEPQSGDL → WISLFGNGRDSSREEFSSS

Note: No experimental confirmation available.
Show »
Length:793
Mass (Da):89,144
Checksum:iD6EA31956390331B
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGM3A0A0C4DGM3_HUMAN
Sorting nexin-29
SNX29
282Annotation score:
H3BQF0H3BQF0_HUMAN
Sorting nexin-29
SNX29
175Annotation score:
H3BT98H3BT98_HUMAN
Sorting nexin-29
SNX29
96Annotation score:
H3BPI1H3BPI1_HUMAN
Sorting nexin-29
SNX29
69Annotation score:

Sequence cautioni

The sequence BAB14033 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti183N → D in BAB14033 (PubMed:14702039).Curated1
Sequence conflicti344S → G in BAB14033 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027281775 – 813ITPPG…QSGDL → WISLFGNGRDSSREEFSSS in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC007216 Genomic DNA No translation available.
AC007598 Genomic DNA No translation available.
AC007601 Genomic DNA No translation available.
AC010333 Genomic DNA No translation available.
AC092365 Genomic DNA No translation available.
AC131391 Genomic DNA No translation available.
AK022425 mRNA Translation: BAB14033.1 Sequence problems.
AK074072 mRNA Translation: BAB84898.1
BC029857 mRNA Translation: AAH29857.1
CCDSiCCDS10553.2 [Q8TEQ0-1]
RefSeqiNP_115543.3, NM_032167.4 [Q8TEQ0-1]
UniGeneiHs.458401

Genome annotation databases

EnsembliENST00000566228; ENSP00000456480; ENSG00000048471 [Q8TEQ0-1]
GeneIDi92017
KEGGihsa:92017
UCSCiuc002dby.6 human [Q8TEQ0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC007216 Genomic DNA No translation available.
AC007598 Genomic DNA No translation available.
AC007601 Genomic DNA No translation available.
AC010333 Genomic DNA No translation available.
AC092365 Genomic DNA No translation available.
AC131391 Genomic DNA No translation available.
AK022425 mRNA Translation: BAB14033.1 Sequence problems.
AK074072 mRNA Translation: BAB84898.1
BC029857 mRNA Translation: AAH29857.1
CCDSiCCDS10553.2 [Q8TEQ0-1]
RefSeqiNP_115543.3, NM_032167.4 [Q8TEQ0-1]
UniGeneiHs.458401

3D structure databases

ProteinModelPortaliQ8TEQ0
SMRiQ8TEQ0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124903, 10 interactors
IntActiQ8TEQ0, 8 interactors

PTM databases

iPTMnetiQ8TEQ0
PhosphoSitePlusiQ8TEQ0

Polymorphism and mutation databases

BioMutaiSNX29
DMDMi353526314

Proteomic databases

EPDiQ8TEQ0
MaxQBiQ8TEQ0
PaxDbiQ8TEQ0
PeptideAtlasiQ8TEQ0
PRIDEiQ8TEQ0
ProteomicsDBi74476
74477 [Q8TEQ0-2]

Protocols and materials databases

DNASUi92017
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000566228; ENSP00000456480; ENSG00000048471 [Q8TEQ0-1]
GeneIDi92017
KEGGihsa:92017
UCSCiuc002dby.6 human [Q8TEQ0-1]

Organism-specific databases

CTDi92017
EuPathDBiHostDB:ENSG00000048471.13
GeneCardsiSNX29
H-InvDBiHIX0012826
HGNCiHGNC:30542 SNX29
HPAiHPA008889
neXtProtiNX_Q8TEQ0
OpenTargetsiENSG00000048471
PharmGKBiPA142670962
PA162404312
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4381 Eukaryota
ENOG410XRAX LUCA
GeneTreeiENSGT00730000110975
HOGENOMiHOG000154364
HOVERGENiHBG108498
InParanoidiQ8TEQ0
KOiK17935
OMAiHSHVLTW
OrthoDBiEOG091G0696

Miscellaneous databases

ChiTaRSiSNX29 human
GenomeRNAii92017
PROiPR:Q8TEQ0

Gene expression databases

BgeeiENSG00000048471 Expressed in 193 organ(s), highest expression level in metanephros
CleanExiHS_RUNDC2A
HS_SNX29
ExpressionAtlasiQ8TEQ0 baseline and differential
GenevisibleiQ8TEQ0 HS

Family and domain databases

CDDicd07277 PX_RUN, 1 hit
Gene3Di3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR001683 Phox
IPR036871 PX_dom_sf
IPR004012 Run_dom
IPR037213 Run_dom_sf
IPR037916 SNX29_PX
PfamiView protein in Pfam
PF00787 PX, 1 hit
PF02759 RUN, 1 hit
SMARTiView protein in SMART
SM00312 PX, 1 hit
SM00593 RUN, 1 hit
SUPFAMiSSF140741 SSF140741, 1 hit
SSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195 PX, 1 hit
PS50826 RUN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSNX29_HUMAN
AccessioniPrimary (citable) accession number: Q8TEQ0
Secondary accession number(s): B5MDW2, Q8N2X2, Q9HA26
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: October 19, 2011
Last modified: September 12, 2018
This is version 112 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again