Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DENN domain-containing protein 1A

Gene

DENND1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Guanine nucleotide exchange factor (GEF) regulating clathrin-mediated endocytosis through RAB35 activation. Promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB35 into its active GTP-bound form. Regulates clathrin-mediated endocytosis of synaptic vesicles and mediates exit from early endosomes (PubMed:20154091, PubMed:20937701). Binds phosphatidylinositol-phosphates (PtdInsPs), with some preference for PtdIns3P (By similarity).By similarity2 Publications

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

The guanine nucleotide exchange factor (GEF) activity is autoinhibited. Autoinhibition may be the result of intramolecular interaction between the DENN domain and the C-terminus, which is disrupted upon phosphorylation. Activation is regulated by Akt activation.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • phosphatidylinositol-3-phosphate binding Source: UniProtKB
  • phosphatidylinositol phosphate binding Source: UniProtKB
  • Rab GTPase binding Source: GO_Central
  • Rab guanyl-nucleotide exchange factor activity Source: UniProtKB
  • SH3 domain binding Source: Ensembl

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor
Biological processProtein transport, Transport
LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DENN domain-containing protein 1AImported
Alternative name(s):
Connecdenn 11 Publication
Short name:
Connecdenn1 Publication
Protein FAM31A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DENND1AImported
Synonyms:FAM31AImported, KIAA1608
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000119522.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29324 DENND1A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613633 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TEH3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Genetic variants in DENND1A may play a role in susceptibility to polycystic ovary syndrome (PCOS), the most common endocrine disease among premenopausal women. PCOS is a complex disorder characterized by infertility, hirsutism, obesity, various menstrual disturbances, and enlarged ovaries studded with atretic follicles.4 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi536 – 538SDS → EDE: Phosphomimetic mutant; abolishes the intramolecular interaction between the DENN domain and the C-terminus of the protein. 1 Publication3

Organism-specific databases

DisGeNET

More...
DisGeNETi
57706

Open Targets

More...
OpenTargetsi
ENSG00000119522

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134876117

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DENND1A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
109825594

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002426801 – 1009DENN domain-containing protein 1AAdd BLAST1009

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei473PhosphoserineCombined sources1
Modified residuei519PhosphothreonineCombined sources1
Modified residuei520PhosphoserineCombined sources1
Modified residuei523PhosphoserineCombined sources1
Modified residuei536PhosphoserineCombined sources1 Publication1
Modified residuei538PhosphoserineCombined sources1 Publication1
Modified residuei546PhosphoserineCombined sources1
Modified residuei592PhosphoserineCombined sources1
Modified residuei749PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine and/or threonine in an Akt-dependent manner. Phosphorylation probably regulates the guanine nucleotide exchange factor (GEF) activity, possibly by disrupting an intramolecular interaction between the DENN domain and the C-terminus of the protein, thereby relieving the autoinhibition.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TEH3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TEH3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TEH3

PeptideAtlas

More...
PeptideAtlasi
Q8TEH3

PRoteomics IDEntifications database

More...
PRIDEi
Q8TEH3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74459
74460 [Q8TEH3-2]
74461 [Q8TEH3-3]
74462 [Q8TEH3-4]
74463 [Q8TEH3-5]
74464 [Q8TEH3-6]
74465 [Q8TEH3-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TEH3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TEH3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000119522 Expressed in 167 organ(s), highest expression level in prefrontal cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_DENND1A

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TEH3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TEH3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA020481

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAB35 (PubMed:20154091). Interacts with clathrin and with the adapter protein complex 2, AP-2 (PubMed:20154091, PubMed:20937701). Interacts with ITSN1 AND SH3GL2 (By similarity). Interacts (when phosphorylated) with YWHAE (PubMed:26055712).By similarity3 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121730, 82 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TEH3, 14 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362727

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8TEH3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TEH3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini13 – 145uDENNPROSITE-ProRule annotationAdd BLAST133
Domaini162 – 298cDENNPROSITE-ProRule annotationAdd BLAST137
Domaini300 – 378dDENNPROSITE-ProRule annotationAdd BLAST79

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi381 – 385FXDXF motif1 Publication5
Motifi569 – 578Clathrin box1 Publication10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi649 – 995Pro-richAdd BLAST347

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3569 Eukaryota
ENOG410XT3N LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156261

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG059210

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TEH3

KEGG Orthology (KO)

More...
KOi
K20160

Identification of Orthologs from Complete Genome Data

More...
OMAi
DDECQRE

Database of Orthologous Groups

More...
OrthoDBi
EOG091G083L

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TEH3

TreeFam database of animal gene trees

More...
TreeFami
TF343037

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001194 cDENN_dom
IPR005112 dDENN_dom
IPR040032 DENND1A/B/C
IPR037516 Tripartite_DENN
IPR005113 uDENN_dom

The PANTHER Classification System

More...
PANTHERi
PTHR13196 PTHR13196, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03455 dDENN, 1 hit
PF02141 DENN, 1 hit
PF03456 uDENN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00801 dDENN, 1 hit
SM00799 DENN, 1 hit
SM00800 uDENN, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50211 DENN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TEH3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSRIKQNPE TTFEVYVEVA YPRTGGTLSD PEVQRQFPED YSDQEVLQTL
60 70 80 90 100
TKFCFPFYVD SLTVSQVGQN FTFVLTDIDS KQRFGFCRLS SGAKSCFCIL
110 120 130 140 150
SYLPWFEVFY KLLNILADYT TKRQENQWNE LLETLHKLPI PDPGVSVHLS
160 170 180 190 200
VHSYFTVPDT RELPSIPENR NLTEYFVAVD VNNMLHLYAS MLYERRILII
210 220 230 240 250
CSKLSTLTAC IHGSAAMLYP MYWQHVYIPV LPPHLLDYCC APMPYLIGIH
260 270 280 290 300
LSLMEKVRNM ALDDVVILNV DTNTLETPFD DLQSLPNDVI SSLKNRLKKV
310 320 330 340 350
STTTGDGVAR AFLKAQAAFF GSYRNALKIE PEEPITFCEE AFVSHYRSGA
360 370 380 390 400
MRQFLQNATQ LQLFKQFIDG RLDLLNSGEG FSDVFEEEIN MGEYAGSDKL
410 420 430 440 450
YHQWLSTVRK GSGAILNTVK TKANPAMKTV YKFAKDHAKM GIKEVKNRLK
460 470 480 490 500
QKDIAENGCA PTPEEQLPKT APSPLVEAKD PKLREDRRPI TVHFGQVRPP
510 520 530 540 550
RPHVVKRPKS NIAVEGRRTS VPSPEQPQPY RTLRESDSAE GDEAESPEQQ
560 570 580 590 600
VRKSTGPVPA PPDRAASIDL LEDVFSNLDM EAALQPLGQA KSLEDLRAPK
610 620 630 640 650
DLREQPGTFD YQRLDLGGSE RSRGVTVALK LTHPYNKLWS LGQDDMAIPS
660 670 680 690 700
KPPAASPEKP SALLGNSLAL PRRPQNRDSI LNPSDKEEVP TPTLGSITIP
710 720 730 740 750
RPQGRKTPEL GIVPPPPIPR PAKLQAAGAA LGDVSERLQT DRDRRAALSP
760 770 780 790 800
GLLPGVVPQG PTELLQPLSP GPGAAGTSSD ALLALLDPLS TAWSGSTLPS
810 820 830 840 850
RPATPNVATP FTPQFSFPPA GTPTPFPQPP LNPFVPSMPA APPTLPLVST
860 870 880 890 900
PAGPFGAPPA SLGPAFASGL LLSSAGFCAP HRSQPNLSAL SMPNLFGQMP
910 920 930 940 950
MGTHTSPLQP LGPPAVAPSR IRTLPLARSS ARAAETKQGL ALRPGDPPLL
960 970 980 990 1000
PPRPPQGLEP TLQPSAPQQA RDPFEDLLQK TKQDVSPSPA LAPAPDSVEQ

LRKQWETFE
Length:1,009
Mass (Da):110,577
Last modified:June 27, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iECEE79CFCD5E2D0C
GO
Isoform 2 (identifier: Q8TEH3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
     560-1009: Missing.

Show »
Length:559
Mass (Da):63,389
Checksum:i64F3CCFF1755CFF9
GO
Isoform 3 (identifier: Q8TEH3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     497-498: VR → AL
     499-1009: Missing.

Show »
Length:498
Mass (Da):56,613
Checksum:i143F57353E24EC46
GO
Isoform 4 (identifier: Q8TEH3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-60: VQRQFPEDYSDQEVLQTLTKFCFPFYVD → MLKWPIPGQVALFQILRCRGNSRRTTVT
     497-498: VR → AL
     499-1009: Missing.

Show »
Length:466
Mass (Da):52,857
Checksum:i98353ACDF34D2AE5
GO
Isoform 5 (identifier: Q8TEH3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: Missing.
     31-43: PEVQRQFPEDYSD → MLKWPIPGQVALF
     527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
     560-1009: Missing.

Show »
Length:529
Mass (Da):59,950
Checksum:iC8D1C7E8FDBA6A9A
GO
Isoform 6 (identifier: Q8TEH3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-42: VQRQFPEDYS → MRRPGDHGLQ
     526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW

Note: No experimental confirmation available.
Show »
Length:1,020
Mass (Da):111,887
Checksum:i4B5FC1CCC9F465C9
GO
Isoform 7 (identifier: Q8TEH3-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     290-331: Missing.
     526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW

Note: No experimental confirmation available.
Show »
Length:1,010
Mass (Da):111,005
Checksum:i1276C13494EBD925
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MS48A0A0A0MS48_HUMAN
DENN domain-containing protein 1A
DENND1A
459Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH09616 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH28061 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAH13155 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti456E → G in BAB15002 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0345091 – 32Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_0345101 – 30Missing in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_03451131 – 43PEVQR…EDYSD → MLKWPIPGQVALF in isoform 5. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_03451233 – 60VQRQF…PFYVD → MLKWPIPGQVALFQILRCRG NSRRTTVT in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_04066633 – 42VQRQFPEDYS → MRRPGDHGLQ in isoform 6. 1 Publication10
Alternative sequenceiVSP_040667290 – 331Missing in isoform 7. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_034513497 – 498VR → AL in isoform 3 and isoform 4. 1 Publication2
Alternative sequenceiVSP_034514499 – 1009Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST511
Alternative sequenceiVSP_040668526Q → HLVKPLRHYAVFLSEDSSDD ECQREEGPSSGFTESFFFSA PFEW in isoform 6 and isoform 7. 1 Publication1
Alternative sequenceiVSP_019464527 – 559PQPYR…TGPVP → NTIATPATLHILQKSITHFA AKFPTRGWTSSSH in isoform 2 and isoform 5. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_019465560 – 1009Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST450

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK024782 mRNA Translation: BAB15002.1
AK074151 mRNA Translation: BAB84977.1
AK295710 mRNA Translation: BAH12164.1
AK299867 mRNA Translation: BAH13155.1 Different initiation.
AC006450 Genomic DNA No translation available.
AL161790 Genomic DNA No translation available.
AL390774 Genomic DNA No translation available.
AL445489 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87571.1
CH471090 Genomic DNA Translation: EAW87575.1
BC009616 mRNA Translation: AAH09616.1 Different initiation.
BC028061 mRNA Translation: AAH28061.1 Different initiation.
BC039703 mRNA Translation: AAH39703.1
BK006958 mRNA Translation: DAA12500.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35133.1 [Q8TEH3-1]
CCDS35134.1 [Q8TEH3-2]
CCDS87687.1 [Q8TEH3-4]

NCBI Reference Sequences

More...
RefSeqi
NP_065997.1, NM_020946.1 [Q8TEH3-1]
NP_079096.2, NM_024820.2 [Q8TEH3-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.744995

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000373618; ENSP00000362720; ENSG00000119522 [Q8TEH3-4]
ENST00000373620; ENSP00000362722; ENSG00000119522 [Q8TEH3-2]
ENST00000373624; ENSP00000362727; ENSG00000119522 [Q8TEH3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57706

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57706

UCSC genome browser

More...
UCSCi
uc004bnz.2 human [Q8TEH3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024782 mRNA Translation: BAB15002.1
AK074151 mRNA Translation: BAB84977.1
AK295710 mRNA Translation: BAH12164.1
AK299867 mRNA Translation: BAH13155.1 Different initiation.
AC006450 Genomic DNA No translation available.
AL161790 Genomic DNA No translation available.
AL390774 Genomic DNA No translation available.
AL445489 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87571.1
CH471090 Genomic DNA Translation: EAW87575.1
BC009616 mRNA Translation: AAH09616.1 Different initiation.
BC028061 mRNA Translation: AAH28061.1 Different initiation.
BC039703 mRNA Translation: AAH39703.1
BK006958 mRNA Translation: DAA12500.1
CCDSiCCDS35133.1 [Q8TEH3-1]
CCDS35134.1 [Q8TEH3-2]
CCDS87687.1 [Q8TEH3-4]
RefSeqiNP_065997.1, NM_020946.1 [Q8TEH3-1]
NP_079096.2, NM_024820.2 [Q8TEH3-2]
UniGeneiHs.744995

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6EKKX-ray1.82A/B2-394[»]
ProteinModelPortaliQ8TEH3
SMRiQ8TEH3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121730, 82 interactors
IntActiQ8TEH3, 14 interactors
STRINGi9606.ENSP00000362727

PTM databases

iPTMnetiQ8TEH3
PhosphoSitePlusiQ8TEH3

Polymorphism and mutation databases

BioMutaiDENND1A
DMDMi109825594

Proteomic databases

EPDiQ8TEH3
MaxQBiQ8TEH3
PaxDbiQ8TEH3
PeptideAtlasiQ8TEH3
PRIDEiQ8TEH3
ProteomicsDBi74459
74460 [Q8TEH3-2]
74461 [Q8TEH3-3]
74462 [Q8TEH3-4]
74463 [Q8TEH3-5]
74464 [Q8TEH3-6]
74465 [Q8TEH3-7]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57706
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373618; ENSP00000362720; ENSG00000119522 [Q8TEH3-4]
ENST00000373620; ENSP00000362722; ENSG00000119522 [Q8TEH3-2]
ENST00000373624; ENSP00000362727; ENSG00000119522 [Q8TEH3-1]
GeneIDi57706
KEGGihsa:57706
UCSCiuc004bnz.2 human [Q8TEH3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57706
DisGeNETi57706
EuPathDBiHostDB:ENSG00000119522.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DENND1A

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0008366
HGNCiHGNC:29324 DENND1A
HPAiHPA020481
MIMi613633 gene
neXtProtiNX_Q8TEH3
OpenTargetsiENSG00000119522
PharmGKBiPA134876117

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3569 Eukaryota
ENOG410XT3N LUCA
GeneTreeiENSGT00940000156261
HOVERGENiHBG059210
InParanoidiQ8TEH3
KOiK20160
OMAiDDECQRE
OrthoDBiEOG091G083L
PhylomeDBiQ8TEH3
TreeFamiTF343037

Enzyme and pathway databases

ReactomeiR-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DENND1A human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DENND1A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57706

Protein Ontology

More...
PROi
PR:Q8TEH3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000119522 Expressed in 167 organ(s), highest expression level in prefrontal cortex
CleanExiHS_DENND1A
ExpressionAtlasiQ8TEH3 baseline and differential
GenevisibleiQ8TEH3 HS

Family and domain databases

InterProiView protein in InterPro
IPR001194 cDENN_dom
IPR005112 dDENN_dom
IPR040032 DENND1A/B/C
IPR037516 Tripartite_DENN
IPR005113 uDENN_dom
PANTHERiPTHR13196 PTHR13196, 2 hits
PfamiView protein in Pfam
PF03455 dDENN, 1 hit
PF02141 DENN, 1 hit
PF03456 uDENN, 1 hit
SMARTiView protein in SMART
SM00801 dDENN, 1 hit
SM00799 DENN, 1 hit
SM00800 uDENN, 1 hit
PROSITEiView protein in PROSITE
PS50211 DENN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDEN1A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TEH3
Secondary accession number(s): A8MZA3
, B1AM80, B7Z3C8, B7Z669, D3PFD3, Q05C88, Q5VWF0, Q6PJZ5, Q8IVD6, Q9H796
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: December 5, 2018
This is version 125 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again