Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (31 Jul 2019)
Sequence version 2 (24 Jul 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Actin filament-associated protein 1-like 1

Gene

AFAP1L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in podosome and invadosome formation.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • SH3 domain binding Source: GO_Central

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Actin filament-associated protein 1-like 1
Short name:
AFAP1-like protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AFAP1L1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26714 AFAP1L1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614410 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TED9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
134265

Open Targets

More...
OpenTargetsi
ENSG00000157510

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162375772

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
AFAP1L1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
156630522

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002952391 – 768Actin filament-associated protein 1-like 1Add BLAST768

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei94PhosphoserineBy similarity1
Modified residuei98PhosphoserineBy similarity1
Modified residuei104PhosphoserineBy similarity1
Modified residuei153PhosphoserineBy similarity1
Modified residuei329PhosphoserineBy similarity1
Modified residuei343PhosphoserineBy similarity1
Modified residuei557PhosphotyrosineBy similarity1
Modified residuei747PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TED9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TED9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TED9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TED9

PeptideAtlas

More...
PeptideAtlasi
Q8TED9

PRoteomics IDEntifications database

More...
PRIDEi
Q8TED9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74452 [Q8TED9-1]
74453 [Q8TED9-2]
74454 [Q8TED9-3]
74455 [Q8TED9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TED9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TED9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in breast, colon and brain. In all 3 tissues, expressed in the microvasculature (at protein level). In addition, in the breast, found in the contractile myoepithelial cell layer which surrounds the breast ducts (at protein level). In the colon, expressed in the mucous membrane and colonic crypts and in the smooth muscle cell layer which provide movement of the colon (at protein level). In the cerebellum, localized around the Purkinje neurons and the granule cells of the granular layer, but not inside cell bodies (at protein level). Outside of the cerebellar cortex, expressed in glial cells (at protein level). Highly expressed away from the cell bodies within the dentate nucleus (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157510 Expressed in 152 organ(s), highest expression level in heart

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TED9 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CTTN.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
GADD45GO952575EBI-1053644,EBI-448202

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126390, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TED9, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000296721

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TED9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini220 – 316PH 1PROSITE-ProRule annotationAdd BLAST97
Domaini418 – 512PH 2PROSITE-ProRule annotationAdd BLAST95

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili611 – 700Sequence analysisAdd BLAST90

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi194 – 198Poly-Glu5

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEU6 Eukaryota
ENOG4111CMN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183067

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000033832

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TED9

Identification of Orthologs from Complete Genome Data

More...
OMAi
KDHTDLR

Database of Orthologous Groups

More...
OrthoDBi
256810at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TED9

TreeFam database of animal gene trees

More...
TreeFami
TF332622

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030113 AFAP
IPR030112 AFAP1L1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR14338 PTHR14338, 1 hit
PTHR14338:SF1 PTHR14338:SF1, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169 PH, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50003 PH_DOMAIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8TED9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRGQVLEQL LPELTGLLSL LDHEYLSDTT LEKKMAVASI LQSLQPLPAK
60 70 80 90 100
EVSYLYVNTA DLHSGPSFVE SLFEEFDCDL SDLRDMPEDD GEPSKGASPE
110 120 130 140 150
LAKSPRLRNA ADLPPPLPNK PPPEDYYEEA LPLGPGKSPE YISSHNGCSP
160 170 180 190 200
SHSIVDGYYE DADSSYPATR VNGELKSSYN DSDAMSSSYE SYDEEEEEGK
210 220 230 240 250
SPQPRHQWPS EEASMHLVRE CRICAFLLRK KRFGQWAKQL TVIREDQLLC
260 270 280 290 300
YKSSKDRQPH LRLALDTCSI IYVPKDSRHK RHELRFTQGA TEVLVLALQS
310 320 330 340 350
REQAEEWLKV IREVSKPVGG AEGVEVPRSP VLLCKLDLDK RLSQEKQTSD
360 370 380 390 400
SDSVGVGDNC STLGRRETCD HGKGKKSSLA ELKGSMSRAA GRKITRIIGF
410 420 430 440 450
SKKKTLADDL QTSSTEEEVP CCGYLNVLVN QGWKERWCRL KCNTLYFHKD
460 470 480 490 500
HMDLRTHVNA IALQGCEVAP GFGPRHPFAF RILRNRQEVA ILEASCSEDM
510 520 530 540 550
GRWLGLLLVE MGSRVTPEAL HYDYVDVETL TSIVSAGRNS FLYARSCQNQ
560 570 580 590 600
WPEPRVYDDV PYEKMQDEEP ERPTGAQVKR HASSCSEKSH RVDPQVKVKR
610 620 630 640 650
HASSANQYKY GKNRAEEDAR RYLVEKEKLE KEKETIRTEL IALRQEKREL
660 670 680 690 700
KEAIRSSPGA KLKALEEAVA TLEAQCRAKE ERRIDLELKL VAVKERLQQS
710 720 730 740 750
LAGGPALGLS VSSKPKSGET ANKPQNSVPE QPLPVNCVSE LRKRSPSIVA
760
SNQGRVLQKA KEWEMKKT
Length:768
Mass (Da):86,432
Last modified:July 24, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5DC1B952E797110F
GO
Isoform 2 (identifier: Q8TED9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     719-761: Missing.

Note: No experimental confirmation available.
Show »
Length:725
Mass (Da):81,750
Checksum:i1C33F71C6CF15D8E
GO
Isoform 3 (identifier: Q8TED9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     341-377: RLSQEKQTSDSDSVGVGDNCSTLGRRETCDHGKGKKS → VYLSPLSLPQARQWPLNTGSTPGELTGWGESQATAKL
     378-768: Missing.

Note: No experimental confirmation available.
Show »
Length:377
Mass (Da):42,197
Checksum:i402A45C59307C01D
GO
Isoform 4 (identifier: Q8TED9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-385: Missing.

Note: No experimental confirmation available.
Show »
Length:383
Mass (Da):43,455
Checksum:iA1040C7B5A813B1E
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB85011 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti84R → Q in BAC04664 (PubMed:14702039).Curated1
Sequence conflicti106R → C in BAC04664 (PubMed:14702039).Curated1
Sequence conflicti325E → G in BAC04664 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0268561 – 385Missing in isoform 4. 1 PublicationAdd BLAST385
Alternative sequenceiVSP_026857341 – 377RLSQE…KGKKS → VYLSPLSLPQARQWPLNTGS TPGELTGWGESQATAKL in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_026858378 – 768Missing in isoform 3. 1 PublicationAdd BLAST391
Alternative sequenceiVSP_026859719 – 761Missing in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK074185 mRNA Translation: BAB85011.1 Different initiation.
AK094067 mRNA Translation: BAC04277.1
AK095980 mRNA Translation: BAC04664.1
BC040723 mRNA Translation: AAH40723.1
BC125093 mRNA Translation: AAI25094.1
BC125094 mRNA Translation: AAI25095.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34274.1 [Q8TED9-1]
CCDS54932.1 [Q8TED9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001139809.1, NM_001146337.2 [Q8TED9-2]
NP_001309991.1, NM_001323062.1
NP_001309992.1, NM_001323063.1 [Q8TED9-3]
NP_689619.1, NM_152406.3 [Q8TED9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296721; ENSP00000296721; ENSG00000157510 [Q8TED9-1]
ENST00000515000; ENSP00000424427; ENSG00000157510 [Q8TED9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
134265

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:134265

UCSC genome browser

More...
UCSCi
uc003lqh.4 human [Q8TED9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074185 mRNA Translation: BAB85011.1 Different initiation.
AK094067 mRNA Translation: BAC04277.1
AK095980 mRNA Translation: BAC04664.1
BC040723 mRNA Translation: AAH40723.1
BC125093 mRNA Translation: AAI25094.1
BC125094 mRNA Translation: AAI25095.1
CCDSiCCDS34274.1 [Q8TED9-1]
CCDS54932.1 [Q8TED9-2]
RefSeqiNP_001139809.1, NM_001146337.2 [Q8TED9-2]
NP_001309991.1, NM_001323062.1
NP_001309992.1, NM_001323063.1 [Q8TED9-3]
NP_689619.1, NM_152406.3 [Q8TED9-1]

3D structure databases

SMRiQ8TED9
ModBaseiSearch...

Protein-protein interaction databases

BioGridi126390, 13 interactors
IntActiQ8TED9, 3 interactors
STRINGi9606.ENSP00000296721

PTM databases

iPTMnetiQ8TED9
PhosphoSitePlusiQ8TED9

Polymorphism and mutation databases

BioMutaiAFAP1L1
DMDMi156630522

Proteomic databases

EPDiQ8TED9
jPOSTiQ8TED9
MaxQBiQ8TED9
PaxDbiQ8TED9
PeptideAtlasiQ8TED9
PRIDEiQ8TED9
ProteomicsDBi74452 [Q8TED9-1]
74453 [Q8TED9-2]
74454 [Q8TED9-3]
74455 [Q8TED9-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
134265
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296721; ENSP00000296721; ENSG00000157510 [Q8TED9-1]
ENST00000515000; ENSP00000424427; ENSG00000157510 [Q8TED9-2]
GeneIDi134265
KEGGihsa:134265
UCSCiuc003lqh.4 human [Q8TED9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
134265
DisGeNETi134265

GeneCards: human genes, protein and diseases

More...
GeneCardsi
AFAP1L1
HGNCiHGNC:26714 AFAP1L1
MIMi614410 gene
neXtProtiNX_Q8TED9
OpenTargetsiENSG00000157510
PharmGKBiPA162375772

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEU6 Eukaryota
ENOG4111CMN LUCA
GeneTreeiENSGT00950000183067
HOGENOMiHOG000033832
InParanoidiQ8TED9
OMAiKDHTDLR
OrthoDBi256810at2759
PhylomeDBiQ8TED9
TreeFamiTF332622

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
AFAP1L1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
134265

Protein Ontology

More...
PROi
PR:Q8TED9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000157510 Expressed in 152 organ(s), highest expression level in heart
GenevisibleiQ8TED9 HS

Family and domain databases

Gene3Di2.30.29.30, 2 hits
InterProiView protein in InterPro
IPR030113 AFAP
IPR030112 AFAP1L1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR14338 PTHR14338, 1 hit
PTHR14338:SF1 PTHR14338:SF1, 1 hit
PfamiView protein in Pfam
PF00169 PH, 2 hits
SMARTiView protein in SMART
SM00233 PH, 2 hits
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAF1L1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TED9
Secondary accession number(s): Q08AN4
, Q08AN5, Q8IW82, Q8N8Z5, Q8N9Q4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: July 31, 2019
This is version 127 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again