Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TBC domain-containing protein kinase-like protein

Gene

TBCK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the modulation of mTOR signaling and expression of mTOR complex components (PubMed:27040691, PubMed:23977024). Involved in the regulation of cell proliferation and growth (PubMed:23977024, PubMed:24576458). Involved in the control of actin-cytoskeleton organization (PubMed:23977024).3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • GTPase activator activity Source: GO_Central
  • protein kinase activity Source: UniProtKB
  • Rab GTPase binding Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8TEA7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
TBC domain-containing protein kinase-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TBCK1 Publication
Synonyms:TBCKL
ORF Names:HSPC302
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000145348.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28261 TBCK

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616899 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TEA7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hypotonia, infantile, with psychomotor retardation and characteristic facies 3 (IHPRF3)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive neurodevelopmental disorder characterized by profound developmental disability, intellectual disability and severe hypotonia. Many patients have seizures, and show brain atrophy, dysgenesis of the corpus callosum and white-matter changes on neuroimaging. Non-specific facial dysmorphism is noted in some individuals.
See also OMIM:616900
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_077816511R → H in IHPRF3. 1 PublicationCorresponds to variant dbSNP:rs869320711EnsemblClinVar.1
Natural variantiVAR_077817551L → P in IHPRF3. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
93627

MalaCards human disease database

More...
MalaCardsi
TBCK
MIMi616900 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000145348

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
488632 TBCK-related intellectual disability syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165664603

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TBCK

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373548

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002732781 – 893TBC domain-containing protein kinase-like proteinAdd BLAST893

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TEA7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TEA7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TEA7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TEA7

PeptideAtlas

More...
PeptideAtlasi
Q8TEA7

PRoteomics IDEntifications database

More...
PRIDEi
Q8TEA7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74430
74431 [Q8TEA7-2]
74432 [Q8TEA7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TEA7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TEA7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000145348 Expressed in 202 organ(s), highest expression level in kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TEA7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TEA7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039951
HPA051611

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125042, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TEA7, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000273980

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8TEA7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TEA7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 273Protein kinasePROSITE-ProRule annotationAdd BLAST273
Domaini466 – 651Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST186
Domaini790 – 889RhodanesePROSITE-ProRule annotationAdd BLAST100

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The protein kinase domain is predicted to be catalytically inactive.Sequence analysis

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1093 Eukaryota
ENOG410Y9M1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158244

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG055536

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TEA7

KEGG Orthology (KO)

More...
KOi
K17544

Identification of Orthologs from Complete Genome Data

More...
OMAi
VCILDGG

Database of Orthologous Groups

More...
OrthoDBi
472287at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TEA7

TreeFam database of animal gene trees

More...
TreeFami
TF106242

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.250.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
IPR001763 Rhodanese-like_dom
IPR036873 Rhodanese-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit
PF00566 RabGAP-TBC, 1 hit
PF00581 Rhodanese, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00450 RHOD, 1 hit
SM00164 TBC, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47923 SSF47923, 2 hits
SSF52821 SSF52821, 1 hit
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS50206 RHODANESE_3, 1 hit
PS50086 TBC_RABGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q8TEA7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFPLKDAEMG AFTFFASALP HDVCGSNGLP LTPNSIKILG RFQILKTITH
60 70 80 90 100
PRLCQYVDIS RGKHERLVVV AEHCERSLED LLRERKPVSC STVLCIAFEV
110 120 130 140 150
LQGLQYMNKH GIVHRALSPH NILLDRKGHI KLAKFGLYHM TAHGDDVDFP
160 170 180 190 200
IGYPSYLAPE VIAQGIFKTT DHMPSKKPLP SGPKSDVWSL GIILFELCVG
210 220 230 240 250
RKLFQSLDIS ERLKFLLTLD CVDDTLIVLA EEHGCLDIIK ELPETVIDLL
260 270 280 290 300
NKCLTFHPSK RPTPDQLMKD KVFSEVSPLY TPFTKPASLF SSSLRCADLT
310 320 330 340 350
LPEDISQLCK DINNDYLAER SIEEVYYLWC LAGGDLEKEL VNKEIIRSKP
360 370 380 390 400
PICTLPNFLF EDGESFGQGR DRSSLLDDTT VTLSLCQLRN RLKDVGGEAF
410 420 430 440 450
YPLLEDDQSN LPHSNSNNEL SAAATLPLII REKDTEYQLN RIILFDRLLK
460 470 480 490 500
AYPYKKNQIW KEARVDIPPL MRGLTWAALL GVEGAIHAKY DAIDKDTPIP
510 520 530 540 550
TDRQIEVDIP RCHQYDELLS SPEGHAKFRR VLKAWVVSHP DLVYWQGLDS
560 570 580 590 600
LCAPFLYLNF NNEALAYACM SAFIPKYLYN FFLKDNSHVI QEYLTVFSQM
610 620 630 640 650
IAFHDPELSN HLNEIGFIPD LYAIPWFLTM FTHVFPLHKI FHLWDTLLLG
660 670 680 690 700
NSSFPFCIGV AILQQLRDRL LANGFNECIL LFSDLPEIDI ERCVRESINL
710 720 730 740 750
FCWTPKSATY RQHAQPPKPS SDSSGGRSSA PYFSAECPDP PKTDLSRESI
760 770 780 790 800
PLNDLKSEVS PRISAEDLID LCELTVTGHF KTPSKKTKSS KPKLLVVDIR
810 820 830 840 850
NSEDFIRGHI SGSINIPFSA AFTAEGELTQ GPYTAMLQNF KGKVIVIVGH
860 870 880 890
VAKHTAEFAA HLVKMKYPRI CILDGGINKI KPTGLLTIPS PQI
Length:893
Mass (Da):100,679
Last modified:January 11, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B5A11E37A49D03B
GO
Isoform 21 Publication (identifier: Q8TEA7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-199: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:854
Mass (Da):96,443
Checksum:iDBF6940FE6D8D60C
GO
Isoform 31 Publication (identifier: Q8TEA7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-152: SCSTVLCIAFEVLQGLQYMNKHGIVHRALSPHNILLDRKGHIKLAKFGLYHMTAHGDDVDFPIG → R

Note: No experimental confirmation available.Curated
Show »
Length:830
Mass (Da):93,725
Checksum:i010755C970CC33F1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5HYF5Q5HYF5_HUMAN
TBC domain-containing protein kinas...
TBCK DKFZp313C1916
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDG2D6RDG2_HUMAN
TBC domain-containing protein kinas...
TBCK
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y959H0Y959_HUMAN
TBC domain-containing protein kinas...
TBCK
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDY5D6RDY5_HUMAN
TBC domain-containing protein kinas...
TBCK
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RC61D6RC61_HUMAN
TBC domain-containing protein kinas...
TBCK
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8U7H0Y8U7_HUMAN
TBC domain-containing protein kinas...
TBCK
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R950D6R950_HUMAN
TBC domain-containing protein kinas...
TBCK
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA45H0YA45_HUMAN
TBC domain-containing protein kinas...
TBCK
24Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF28980 differs from that shown. Reason: Frameshift at positions 507, 516, 660, 665 and 672.Curated
The sequence BAC05244 differs from that shown. intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti601I → N in AAF28980 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04138066R → L1 PublicationCorresponds to variant dbSNP:rs35784409Ensembl.1
Natural variantiVAR_041381151I → M1 PublicationCorresponds to variant dbSNP:rs35835241Ensembl.1
Natural variantiVAR_041382265D → N1 PublicationCorresponds to variant dbSNP:rs34770077Ensembl.1
Natural variantiVAR_030123266Q → E4 PublicationsCorresponds to variant dbSNP:rs3775091Ensembl.1
Natural variantiVAR_041383425T → M1 PublicationCorresponds to variant dbSNP:rs34307452Ensembl.1
Natural variantiVAR_041384471M → I1 PublicationCorresponds to variant dbSNP:rs34961213Ensembl.1
Natural variantiVAR_030124489K → N1 PublicationCorresponds to variant dbSNP:rs2305685Ensembl.1
Natural variantiVAR_041385503R → I in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_077816511R → H in IHPRF3. 1 PublicationCorresponds to variant dbSNP:rs869320711EnsemblClinVar.1
Natural variantiVAR_077817551L → P in IHPRF3. 1 Publication1
Natural variantiVAR_041386692R → C1 PublicationCorresponds to variant dbSNP:rs35790205Ensembl.1
Natural variantiVAR_041387806I → V in a head & Neck squamous cell carcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05227489 – 152SCSTV…DFPIG → R in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_052275161 – 199Missing in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB449876 mRNA Translation: BAH16619.1
AK074305 mRNA Translation: BAB85045.1
AK098157 mRNA Translation: BAC05244.1 Sequence problems.
AC093680 Genomic DNA No translation available.
AC107381 Genomic DNA Translation: AAY40979.1
AC109361 Genomic DNA No translation available.
AC114734 Genomic DNA Translation: AAY41041.1
AC125469 Genomic DNA No translation available.
AP001820 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06201.1
BC009208 mRNA Translation: AAH09208.2
BC020853 mRNA Translation: AAH20853.2
BC068496 mRNA Translation: AAH68496.1
AF161420 mRNA Translation: AAF28980.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3673.1 [Q8TEA7-3]
CCDS54788.1 [Q8TEA7-1]
CCDS54789.1 [Q8TEA7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001156907.1, NM_001163435.2
NP_001156908.1, NM_001163436.2
NP_001156909.1, NM_001163437.2
NP_149106.2, NM_033115.4
XP_011530719.1, XM_011532417.2 [Q8TEA7-1]
XP_016864335.1, XM_017008846.1 [Q8TEA7-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.151498
Hs.292986

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000273980; ENSP00000273980; ENSG00000145348 [Q8TEA7-1]
ENST00000361687; ENSP00000355338; ENSG00000145348 [Q8TEA7-3]
ENST00000394706; ENSP00000378196; ENSG00000145348 [Q8TEA7-2]
ENST00000394708; ENSP00000378198; ENSG00000145348 [Q8TEA7-1]
ENST00000432496; ENSP00000405847; ENSG00000145348 [Q8TEA7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
93627

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:93627

UCSC genome browser

More...
UCSCi
uc003hyc.3 human [Q8TEA7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB449876 mRNA Translation: BAH16619.1
AK074305 mRNA Translation: BAB85045.1
AK098157 mRNA Translation: BAC05244.1 Sequence problems.
AC093680 Genomic DNA No translation available.
AC107381 Genomic DNA Translation: AAY40979.1
AC109361 Genomic DNA No translation available.
AC114734 Genomic DNA Translation: AAY41041.1
AC125469 Genomic DNA No translation available.
AP001820 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06201.1
BC009208 mRNA Translation: AAH09208.2
BC020853 mRNA Translation: AAH20853.2
BC068496 mRNA Translation: AAH68496.1
AF161420 mRNA Translation: AAF28980.1 Frameshift.
CCDSiCCDS3673.1 [Q8TEA7-3]
CCDS54788.1 [Q8TEA7-1]
CCDS54789.1 [Q8TEA7-2]
RefSeqiNP_001156907.1, NM_001163435.2
NP_001156908.1, NM_001163436.2
NP_001156909.1, NM_001163437.2
NP_149106.2, NM_033115.4
XP_011530719.1, XM_011532417.2 [Q8TEA7-1]
XP_016864335.1, XM_017008846.1 [Q8TEA7-1]
UniGeneiHs.151498
Hs.292986

3D structure databases

ProteinModelPortaliQ8TEA7
SMRiQ8TEA7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125042, 7 interactors
IntActiQ8TEA7, 2 interactors
STRINGi9606.ENSP00000273980

PTM databases

iPTMnetiQ8TEA7
PhosphoSitePlusiQ8TEA7

Polymorphism and mutation databases

BioMutaiTBCK
DMDMi317373548

Proteomic databases

EPDiQ8TEA7
jPOSTiQ8TEA7
MaxQBiQ8TEA7
PaxDbiQ8TEA7
PeptideAtlasiQ8TEA7
PRIDEiQ8TEA7
ProteomicsDBi74430
74431 [Q8TEA7-2]
74432 [Q8TEA7-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
93627
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000273980; ENSP00000273980; ENSG00000145348 [Q8TEA7-1]
ENST00000361687; ENSP00000355338; ENSG00000145348 [Q8TEA7-3]
ENST00000394706; ENSP00000378196; ENSG00000145348 [Q8TEA7-2]
ENST00000394708; ENSP00000378198; ENSG00000145348 [Q8TEA7-1]
ENST00000432496; ENSP00000405847; ENSG00000145348 [Q8TEA7-1]
GeneIDi93627
KEGGihsa:93627
UCSCiuc003hyc.3 human [Q8TEA7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
93627
DisGeNETi93627
EuPathDBiHostDB:ENSG00000145348.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TBCK
HGNCiHGNC:28261 TBCK
HPAiHPA039951
HPA051611
MalaCardsiTBCK
MIMi616899 gene
616900 phenotype
neXtProtiNX_Q8TEA7
OpenTargetsiENSG00000145348
Orphaneti488632 TBCK-related intellectual disability syndrome
PharmGKBiPA165664603

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1093 Eukaryota
ENOG410Y9M1 LUCA
GeneTreeiENSGT00940000158244
HOVERGENiHBG055536
InParanoidiQ8TEA7
KOiK17544
OMAiVCILDGG
OrthoDBi472287at2759
PhylomeDBiQ8TEA7
TreeFamiTF106242

Enzyme and pathway databases

SignaLinkiQ8TEA7

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TBCK human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
93627

Protein Ontology

More...
PROi
PR:Q8TEA7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000145348 Expressed in 202 organ(s), highest expression level in kidney
ExpressionAtlasiQ8TEA7 baseline and differential
GenevisibleiQ8TEA7 HS

Family and domain databases

Gene3Di3.40.250.10, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
IPR001763 Rhodanese-like_dom
IPR036873 Rhodanese-like_dom_sf
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
PF00566 RabGAP-TBC, 1 hit
PF00581 Rhodanese, 1 hit
SMARTiView protein in SMART
SM00450 RHOD, 1 hit
SM00164 TBC, 1 hit
SUPFAMiSSF47923 SSF47923, 2 hits
SSF52821 SSF52821, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS50206 RHODANESE_3, 1 hit
PS50086 TBC_RABGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTBCK_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TEA7
Secondary accession number(s): B9A6J1
, Q4W5B3, Q4W5E1, Q6NUP4, Q8N7M8, Q8WW57, Q96GV6, Q9P080
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 11, 2011
Last modified: January 16, 2019
This is version 136 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again