Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (13 Feb 2019)
Sequence version 2 (22 Nov 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein phosphatase Slingshot homolog 3

Gene

SSH3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protein phosphatase which may play a role in the regulation of actin filament dynamics. Can dephosphorylate and activate the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly (By similarity).By similarity

Miscellaneous

Tyrosine phosphatase activity has not been demonstrated for this protein to date.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei413Phosphocysteine intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8TE77

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein phosphatase Slingshot homolog 3 (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
SSH-like protein 3
Short name:
SSH-3L
Short name:
hSSH-3L
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SSH3
Synonyms:SSH3L
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000172830.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30581 SSH3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606780 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TE77

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000172830

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134929326

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SSH3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
82582268

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000948452 – 659Protein phosphatase Slingshot homolog 3Add BLAST658

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei9PhosphoserineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei85PhosphoserineCombined sources1
Modified residuei87PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TE77

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TE77

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TE77

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TE77

PeptideAtlas

More...
PeptideAtlasi
Q8TE77

PRoteomics IDEntifications database

More...
PRIDEi
Q8TE77

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74414
74415 [Q8TE77-2]
74416 [Q8TE77-3]
74417 [Q8TE77-4]
74418 [Q8TE77-5]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q8TE77

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TE77

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TE77

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172830 Expressed in 206 organ(s), highest expression level in lower esophagus mucosa

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TE77 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TE77 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019949
HPA019957

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Does not bind to, or colocalize with, filamentous actin.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120299, 38 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TE77, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000312081

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8TE77

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TE77

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini328 – 468Tyrosine-protein phosphataseAdd BLAST141

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1716 Eukaryota
COG2453 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160322

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG089321

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TE77

KEGG Orthology (KO)

More...
KOi
K05766

Identification of Orthologs from Complete Genome Data

More...
OMAi
RNRVTHI

Database of Orthologous Groups

More...
OrthoDBi
1576308at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TE77

TreeFam database of animal gene trees

More...
TreeFami
TF319444

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00127 DSPc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR014876 DEK_C
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10159 PTHR10159, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08766 DEK_C, 1 hit
PF00782 DSPc, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00195 DSPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TE77-1) [UniParc]FASTAAdd to basket
Also known as: L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALVTVSRSP PGSGASTPVG PWDQAVQRRS RLQRRQSFAV LRGAVLGLQD
60 70 80 90 100
GGDNDDAAEA SSEPTEKAPS EEELHGDQTD FGQGSQSPQK QEEQRQHLHL
110 120 130 140 150
MVQLLRPQDD IRLAAQLEAP RPPRLRYLLV VSTREGEGLS QDETVLLGVD
160 170 180 190 200
FPDSSSPSCT LGLVLPLWSD TQVYLDGDGG FSVTSGGQSR IFKPISIQTM
210 220 230 240 250
WATLQVLHQA CEAALGSGLV PGGSALTWAS HYQERLNSEQ SCLNEWTAMA
260 270 280 290 300
DLESLRPPSA EPGGSSEQEQ MEQAIRAELW KVLDVSDLES VTSKEIRQAL
310 320 330 340 350
ELRLGLPLQQ YRDFIDNQML LLVAQRDRAS RIFPHLYLGS EWNAANLEEL
360 370 380 390 400
QRNRVTHILN MAREIDNFYP ERFTYHNVRL WDEESAQLLP HWKETHRFIE
410 420 430 440 450
AARAQGTHVL VHCKMGVSRS AATVLAYAMK QYECSLEQAL RHVQELRPIA
460 470 480 490 500
RPNPGFLRQL QIYQGILTAS RQSHVWEQKV GGVSPEEHPA PEVSTPFPPL
510 520 530 540 550
PPEPEGGGEE KVVGMEESQA APKEEPGPRP RINLRGVMRS ISLLEPSLEL
560 570 580 590 600
ESTSETSDMP EVFSSHESSH EEPLQPFPQL ARTKGGQQVD RGPQPALKSR
610 620 630 640 650
QSVVTLQGSA VVANRTQAFQ EQEQGQGQGQ GEPCISSTPR FRKVVRQASV

HDSGEEGEA
Length:659
Mass (Da):72,996
Last modified:November 22, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0D96F86EAFE81D3B
GO
Isoform 2 (identifier: Q8TE77-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     470-471: SR → RT
     472-659: Missing.

Show »
Length:471
Mass (Da):52,713
Checksum:i826A8914B638DCC0
GO
Isoform 3 (identifier: Q8TE77-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.
     147-154: LGVDFPDS → MAFPLSPA

Show »
Length:513
Mass (Da):56,982
Checksum:iCA5FF8403E02B99F
GO
Isoform 4 (identifier: Q8TE77-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     283-547: Missing.

Note: No experimental confirmation available.
Show »
Length:394
Mass (Da):42,724
Checksum:iF87C7F5A29048AAE
GO
Isoform 5 (identifier: Q8TE77-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-330: Missing.
     331-360: RIFPHLYLGSEWNAANLEELQRNRVTHILN → MEGTMMMQQRPVLSQQHPSFILNSSPAHSP
     470-471: SR → RT
     472-659: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):16,357
Checksum:i5B268790931CA5B6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PIT5E9PIT5_HUMAN
Protein phosphatase Slingshot homol...
SSH3
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JUG3C9JUG3_HUMAN
Protein phosphatase Slingshot homol...
SSH3 hCG_21061
394Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWG1A0A087WWG1_HUMAN
Protein phosphatase Slingshot homol...
SSH3
316Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMS1E9PMS1_HUMAN
Protein phosphatase Slingshot homol...
SSH3
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti58A → V (PubMed:11832213).Curated1
Sequence conflicti58A → V (PubMed:14531860).Curated1
Sequence conflicti509E → G in BAC04314 (PubMed:14702039).Curated1
Sequence conflicti641F → S in BAB85080 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057132239E → V. Corresponds to variant dbSNP:rs7114712Ensembl.1
Natural variantiVAR_057133600R → H. Corresponds to variant dbSNP:rs1573536Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0163301 – 330Missing in isoform 5. 1 PublicationAdd BLAST330
Alternative sequenceiVSP_0163311 – 146Missing in isoform 3. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_016332147 – 154LGVDFPDS → MAFPLSPA in isoform 3. 1 Publication8
Alternative sequenceiVSP_016333283 – 547Missing in isoform 4. 1 PublicationAdd BLAST265
Alternative sequenceiVSP_016334331 – 360RIFPH…THILN → MEGTMMMQQRPVLSQQHPSF ILNSSPAHSP in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_016335470 – 471SR → RT in isoform 2 and isoform 5. 2 Publications2
Alternative sequenceiVSP_016336472 – 659Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST188

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB072360 mRNA Translation: BAB84119.3
AB099291 mRNA Translation: BAC97814.1
AK000522 mRNA Translation: BAA91228.1
AK001790 mRNA Translation: BAA91913.1
AK074432 mRNA Translation: BAB85080.1
AK094226 mRNA Translation: BAC04314.1
BC007709 mRNA Translation: AAH07709.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8157.1 [Q8TE77-1]

NCBI Reference Sequences

More...
RefSeqi
NP_060327.3, NM_017857.3 [Q8TE77-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.29173

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000308127; ENSP00000312081; ENSG00000172830 [Q8TE77-1]
ENST00000376757; ENSP00000365948; ENSG00000172830 [Q8TE77-3]
ENST00000532881; ENSP00000431788; ENSG00000172830 [Q8TE77-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54961

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54961

UCSC genome browser

More...
UCSCi
uc001okj.4 human [Q8TE77-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB072360 mRNA Translation: BAB84119.3
AB099291 mRNA Translation: BAC97814.1
AK000522 mRNA Translation: BAA91228.1
AK001790 mRNA Translation: BAA91913.1
AK074432 mRNA Translation: BAB85080.1
AK094226 mRNA Translation: BAC04314.1
BC007709 mRNA Translation: AAH07709.1
CCDSiCCDS8157.1 [Q8TE77-1]
RefSeqiNP_060327.3, NM_017857.3 [Q8TE77-1]
UniGeneiHs.29173

3D structure databases

ProteinModelPortaliQ8TE77
SMRiQ8TE77
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120299, 38 interactors
IntActiQ8TE77, 6 interactors
STRINGi9606.ENSP00000312081

PTM databases

DEPODiQ8TE77
iPTMnetiQ8TE77
PhosphoSitePlusiQ8TE77

Polymorphism and mutation databases

BioMutaiSSH3
DMDMi82582268

Proteomic databases

EPDiQ8TE77
jPOSTiQ8TE77
MaxQBiQ8TE77
PaxDbiQ8TE77
PeptideAtlasiQ8TE77
PRIDEiQ8TE77
ProteomicsDBi74414
74415 [Q8TE77-2]
74416 [Q8TE77-3]
74417 [Q8TE77-4]
74418 [Q8TE77-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
54961
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000308127; ENSP00000312081; ENSG00000172830 [Q8TE77-1]
ENST00000376757; ENSP00000365948; ENSG00000172830 [Q8TE77-3]
ENST00000532881; ENSP00000431788; ENSG00000172830 [Q8TE77-2]
GeneIDi54961
KEGGihsa:54961
UCSCiuc001okj.4 human [Q8TE77-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54961
EuPathDBiHostDB:ENSG00000172830.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SSH3
HGNCiHGNC:30581 SSH3
HPAiHPA019949
HPA019957
MIMi606780 gene
neXtProtiNX_Q8TE77
OpenTargetsiENSG00000172830
PharmGKBiPA134929326

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00940000160322
HOVERGENiHBG089321
InParanoidiQ8TE77
KOiK05766
OMAiRNRVTHI
OrthoDBi1576308at2759
PhylomeDBiQ8TE77
TreeFamiTF319444

Enzyme and pathway databases

SIGNORiQ8TE77

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SSH3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54961

Protein Ontology

More...
PROi
PR:Q8TE77

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172830 Expressed in 206 organ(s), highest expression level in lower esophagus mucosa
ExpressionAtlasiQ8TE77 baseline and differential
GenevisibleiQ8TE77 HS

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR014876 DEK_C
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF08766 DEK_C, 1 hit
PF00782 DSPc, 1 hit
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSSH3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TE77
Secondary accession number(s): Q6PK42
, Q76I75, Q8N9L8, Q8WYL0, Q9NV45, Q9NWZ7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: November 22, 2005
Last modified: February 13, 2019
This is version 147 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again