Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase Slingshot homolog 3

Gene

SSH3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Protein phosphatase which may play a role in the regulation of actin filament dynamics. Can dephosphorylate and activate the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly (By similarity).By similarity

Miscellaneous

Tyrosine phosphatase activity has not been demonstrated for this protein to date.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei413Phosphocysteine intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

SIGNORiQ8TE77

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase Slingshot homolog 3 (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
SSH-like protein 3
Short name:
SSH-3L
Short name:
hSSH-3L
Gene namesi
Name:SSH3
Synonyms:SSH3L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000172830.12
HGNCiHGNC:30581 SSH3
MIMi606780 gene
neXtProtiNX_Q8TE77

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000172830
PharmGKBiPA134929326

Polymorphism and mutation databases

BioMutaiSSH3
DMDMi82582268

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000948452 – 659Protein phosphatase Slingshot homolog 3Add BLAST658

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei9PhosphoserineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei85PhosphoserineCombined sources1
Modified residuei87PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8TE77
MaxQBiQ8TE77
PaxDbiQ8TE77
PeptideAtlasiQ8TE77
PRIDEiQ8TE77
ProteomicsDBi74414
74415 [Q8TE77-2]
74416 [Q8TE77-3]
74417 [Q8TE77-4]
74418 [Q8TE77-5]

PTM databases

DEPODiQ8TE77
iPTMnetiQ8TE77
PhosphoSitePlusiQ8TE77

Expressioni

Gene expression databases

BgeeiENSG00000172830 Expressed in 206 organ(s), highest expression level in lower esophagus mucosa
CleanExiHS_SSH3
ExpressionAtlasiQ8TE77 baseline and differential
GenevisibleiQ8TE77 HS

Organism-specific databases

HPAiHPA019949
HPA019957

Interactioni

Subunit structurei

Does not bind to, or colocalize with, filamentous actin.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120299, 38 interactors
IntActiQ8TE77, 6 interactors
STRINGi9606.ENSP00000312081

Structurei

3D structure databases

ProteinModelPortaliQ8TE77
SMRiQ8TE77
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini328 – 468Tyrosine-protein phosphataseAdd BLAST141

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00760000118902
HOVERGENiHBG089321
InParanoidiQ8TE77
KOiK05766
OMAiRNRVTHI
OrthoDBiEOG091G0249
PhylomeDBiQ8TE77
TreeFamiTF319444

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR014876 DEK_C
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF08766 DEK_C, 1 hit
PF00782 DSPc, 1 hit
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TE77-1) [UniParc]FASTAAdd to basket
Also known as: L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALVTVSRSP PGSGASTPVG PWDQAVQRRS RLQRRQSFAV LRGAVLGLQD
60 70 80 90 100
GGDNDDAAEA SSEPTEKAPS EEELHGDQTD FGQGSQSPQK QEEQRQHLHL
110 120 130 140 150
MVQLLRPQDD IRLAAQLEAP RPPRLRYLLV VSTREGEGLS QDETVLLGVD
160 170 180 190 200
FPDSSSPSCT LGLVLPLWSD TQVYLDGDGG FSVTSGGQSR IFKPISIQTM
210 220 230 240 250
WATLQVLHQA CEAALGSGLV PGGSALTWAS HYQERLNSEQ SCLNEWTAMA
260 270 280 290 300
DLESLRPPSA EPGGSSEQEQ MEQAIRAELW KVLDVSDLES VTSKEIRQAL
310 320 330 340 350
ELRLGLPLQQ YRDFIDNQML LLVAQRDRAS RIFPHLYLGS EWNAANLEEL
360 370 380 390 400
QRNRVTHILN MAREIDNFYP ERFTYHNVRL WDEESAQLLP HWKETHRFIE
410 420 430 440 450
AARAQGTHVL VHCKMGVSRS AATVLAYAMK QYECSLEQAL RHVQELRPIA
460 470 480 490 500
RPNPGFLRQL QIYQGILTAS RQSHVWEQKV GGVSPEEHPA PEVSTPFPPL
510 520 530 540 550
PPEPEGGGEE KVVGMEESQA APKEEPGPRP RINLRGVMRS ISLLEPSLEL
560 570 580 590 600
ESTSETSDMP EVFSSHESSH EEPLQPFPQL ARTKGGQQVD RGPQPALKSR
610 620 630 640 650
QSVVTLQGSA VVANRTQAFQ EQEQGQGQGQ GEPCISSTPR FRKVVRQASV

HDSGEEGEA
Length:659
Mass (Da):72,996
Last modified:November 22, 2005 - v2
Checksum:i0D96F86EAFE81D3B
GO
Isoform 2 (identifier: Q8TE77-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     470-471: SR → RT
     472-659: Missing.

Show »
Length:471
Mass (Da):52,713
Checksum:i826A8914B638DCC0
GO
Isoform 3 (identifier: Q8TE77-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.
     147-154: LGVDFPDS → MAFPLSPA

Show »
Length:513
Mass (Da):56,982
Checksum:iCA5FF8403E02B99F
GO
Isoform 4 (identifier: Q8TE77-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     283-547: Missing.

Note: No experimental confirmation available.
Show »
Length:394
Mass (Da):42,724
Checksum:iF87C7F5A29048AAE
GO
Isoform 5 (identifier: Q8TE77-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-330: Missing.
     331-360: RIFPHLYLGSEWNAANLEELQRNRVTHILN → MEGTMMMQQRPVLSQQHPSFILNSSPAHSP
     470-471: SR → RT
     472-659: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):16,357
Checksum:i5B268790931CA5B6
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PIT5E9PIT5_HUMAN
Protein phosphatase Slingshot homol...
SSH3
219Annotation score:
C9JUG3C9JUG3_HUMAN
Protein phosphatase Slingshot homol...
SSH3 hCG_21061
394Annotation score:
A0A087WWG1A0A087WWG1_HUMAN
Protein phosphatase Slingshot homol...
SSH3
316Annotation score:
E9PMS1E9PMS1_HUMAN
Protein phosphatase Slingshot homol...
SSH3
41Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti58A → V (PubMed:11832213).Curated1
Sequence conflicti58A → V (PubMed:14531860).Curated1
Sequence conflicti509E → G in BAC04314 (PubMed:14702039).Curated1
Sequence conflicti641F → S in BAB85080 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057132239E → V. Corresponds to variant dbSNP:rs7114712Ensembl.1
Natural variantiVAR_057133600R → H. Corresponds to variant dbSNP:rs1573536Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0163301 – 330Missing in isoform 5. 1 PublicationAdd BLAST330
Alternative sequenceiVSP_0163311 – 146Missing in isoform 3. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_016332147 – 154LGVDFPDS → MAFPLSPA in isoform 3. 1 Publication8
Alternative sequenceiVSP_016333283 – 547Missing in isoform 4. 1 PublicationAdd BLAST265
Alternative sequenceiVSP_016334331 – 360RIFPH…THILN → MEGTMMMQQRPVLSQQHPSF ILNSSPAHSP in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_016335470 – 471SR → RT in isoform 2 and isoform 5. 2 Publications2
Alternative sequenceiVSP_016336472 – 659Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST188

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB072360 mRNA Translation: BAB84119.3
AB099291 mRNA Translation: BAC97814.1
AK000522 mRNA Translation: BAA91228.1
AK001790 mRNA Translation: BAA91913.1
AK074432 mRNA Translation: BAB85080.1
AK094226 mRNA Translation: BAC04314.1
BC007709 mRNA Translation: AAH07709.1
CCDSiCCDS8157.1 [Q8TE77-1]
RefSeqiNP_060327.3, NM_017857.3 [Q8TE77-1]
UniGeneiHs.29173

Genome annotation databases

EnsembliENST00000308127; ENSP00000312081; ENSG00000172830 [Q8TE77-1]
ENST00000376757; ENSP00000365948; ENSG00000172830 [Q8TE77-3]
ENST00000532881; ENSP00000431788; ENSG00000172830 [Q8TE77-2]
GeneIDi54961
KEGGihsa:54961
UCSCiuc001okj.4 human [Q8TE77-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB072360 mRNA Translation: BAB84119.3
AB099291 mRNA Translation: BAC97814.1
AK000522 mRNA Translation: BAA91228.1
AK001790 mRNA Translation: BAA91913.1
AK074432 mRNA Translation: BAB85080.1
AK094226 mRNA Translation: BAC04314.1
BC007709 mRNA Translation: AAH07709.1
CCDSiCCDS8157.1 [Q8TE77-1]
RefSeqiNP_060327.3, NM_017857.3 [Q8TE77-1]
UniGeneiHs.29173

3D structure databases

ProteinModelPortaliQ8TE77
SMRiQ8TE77
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120299, 38 interactors
IntActiQ8TE77, 6 interactors
STRINGi9606.ENSP00000312081

PTM databases

DEPODiQ8TE77
iPTMnetiQ8TE77
PhosphoSitePlusiQ8TE77

Polymorphism and mutation databases

BioMutaiSSH3
DMDMi82582268

Proteomic databases

EPDiQ8TE77
MaxQBiQ8TE77
PaxDbiQ8TE77
PeptideAtlasiQ8TE77
PRIDEiQ8TE77
ProteomicsDBi74414
74415 [Q8TE77-2]
74416 [Q8TE77-3]
74417 [Q8TE77-4]
74418 [Q8TE77-5]

Protocols and materials databases

DNASUi54961
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000308127; ENSP00000312081; ENSG00000172830 [Q8TE77-1]
ENST00000376757; ENSP00000365948; ENSG00000172830 [Q8TE77-3]
ENST00000532881; ENSP00000431788; ENSG00000172830 [Q8TE77-2]
GeneIDi54961
KEGGihsa:54961
UCSCiuc001okj.4 human [Q8TE77-1]

Organism-specific databases

CTDi54961
EuPathDBiHostDB:ENSG00000172830.12
GeneCardsiSSH3
HGNCiHGNC:30581 SSH3
HPAiHPA019949
HPA019957
MIMi606780 gene
neXtProtiNX_Q8TE77
OpenTargetsiENSG00000172830
PharmGKBiPA134929326
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00760000118902
HOVERGENiHBG089321
InParanoidiQ8TE77
KOiK05766
OMAiRNRVTHI
OrthoDBiEOG091G0249
PhylomeDBiQ8TE77
TreeFamiTF319444

Enzyme and pathway databases

SIGNORiQ8TE77

Miscellaneous databases

GeneWikiiSSH3
GenomeRNAii54961
PROiPR:Q8TE77
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172830 Expressed in 206 organ(s), highest expression level in lower esophagus mucosa
CleanExiHS_SSH3
ExpressionAtlasiQ8TE77 baseline and differential
GenevisibleiQ8TE77 HS

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR014876 DEK_C
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF08766 DEK_C, 1 hit
PF00782 DSPc, 1 hit
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSSH3_HUMAN
AccessioniPrimary (citable) accession number: Q8TE77
Secondary accession number(s): Q6PK42
, Q76I75, Q8N9L8, Q8WYL0, Q9NV45, Q9NWZ7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: November 22, 2005
Last modified: November 7, 2018
This is version 144 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again