Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8TE68 (ES8L1_HUMAN)

Entry version 146 (22 Apr 2020)
Sequence version 3 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Epidermal growth factor receptor kinase substrate 8-like protein 1

Gene

EPS8L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Epidermal growth factor receptor kinase substrate 8-like protein 1
Short name:
EPS8-like protein 1
Alternative name(s):
Epidermal growth factor receptor pathway substrate 8-related protein 1
Short name:
EPS8-related protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EPS8L1
Synonyms:DRC3, EPS8R1
ORF Names:PP10566
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:21295 EPS8L1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		614987 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8TE68

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000131037

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134990326

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8TE68 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		EPS8L1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002390821 – 723Epidermal growth factor receptor kinase substrate 8-like protein 1Add BLAST723

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei182PhosphoserineCombined sources1
Modified residuei187PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8TE68

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8TE68

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8TE68

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8TE68

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8TE68

PeptideAtlas

More...PeptideAtlasi		Q8TE68

PRoteomics IDEntifications database

More...PRIDEi		Q8TE68

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		74407 [Q8TE68-1]
74408 [Q8TE68-2]
74409 [Q8TE68-3]
74410 [Q8TE68-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8TE68

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8TE68

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000131037 Expressed in lower esophagus mucosa and 171 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8TE68 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8TE68 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000131037 Tissue enhanced (esophagus, placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ABI1.

Part of a complex that contains SOS1, ABI1 and EPS8L2. Associates with F-actin.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		120218, 12 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8TE68

Protein interaction database and analysis system

More...IntActi		Q8TE68, 8 interactors

Molecular INTeraction database

More...MINTi		Q8TE68

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000201647

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8TE68 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1723
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8TE68

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q8TE68

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini478 – 537SH3PROSITE-ProRule annotationAdd BLAST60

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili689 – 719Sequence analysisAdd BLAST31

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi119 – 122Poly-Leu4
Compositional biasi448 – 451Poly-Arg4
Compositional biasi534 – 576Pro-richAdd BLAST43

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the EPS8 family.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IP0J Eukaryota
ENOG4111F7Z LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158125

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_014510_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8TE68

KEGG Orthology (KO)

More...KOi		K17277

Identification of Orthologs from Complete Genome Data

More...OMAi		SQYLVNH

Database of Orthologous Groups

More...OrthoDBi		218804at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8TE68

TreeFam database of animal gene trees

More...TreeFami		TF313069

Family and domain databases

Conserved Domains Database

More...CDDi		cd01210 PTB_EPS8, 1 hit
cd11764 SH3_Eps8, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.150.50, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039801 EPS8-like
IPR033928 EPS8_PTB
IPR035462 Eps8_SH3
IPR011993 PH-like_dom_sf
IPR013625 PTB
IPR006020 PTB/PI_dom
IPR013761 SAM/pointed_sf
IPR041418 SAM_3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

The PANTHER Classification System

More...PANTHERi		PTHR12287 PTHR12287, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08416 PTB, 1 hit
PF18016 SAM_3, 1 hit
PF00018 SH3_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00462 PTB, 1 hit
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TE68-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTATGPEAA PKPSAKSIYE QRKRYSTVVM ADVSQYPVNH LVTFCLGEDD 
        60         70         80         90        100
GVHTVEDASR KLAVMDSQGR VWAQEMLLRV SPDHVTLLDP ASKEELESYP 
       110        120        130        140        150
LGAIVRCDAV MPPGRSRSLL LLVCQEPERA QPDVHFFQGL RLGAELIRED 
       160        170        180        190        200
IQGALHNYRS GRGERRAAAL RATQEELQRD RSPAAETPPL QRRPSVRAVI 
       210        220        230        240        250
STVERGAGRG RPQAKPIPEA EEAQRPEPVG TSSNADSASP DLGPRGPDLA 
       260        270        280        290        300
VLQAEREVDI LNHVFDDVES FVSRLQKSAE AARVLEHRER GRRSRRRAAG 
       310        320        330        340        350
EGLLTLRAKP PSEAEYTDVL QKIKYAFSLL ARLRGNIADP SSPELLHFLF 
       360        370        380        390        400
GPLQMIVNTS GGPEFASSVR RPHLTSDAVA LLRDNVTPRE NELWTSLGDS 
       410        420        430        440        450
WTRPGLELSP EEGPPYRPEF FSGWEPPVTD PQSRAWEDPV EKQLQHERRR 
       460        470        480        490        500
RQQSAPQVAV NGHRDLEPES EPQLESETAG KWVLCNYDFQ ARNSSELSVK 
       510        520        530        540        550
QRDVLEVLDD SRKWWKVRDP AGQEGYVPYN ILTPYPGPRL HHSQSPARSL 
       560        570        580        590        600
NSTPPPPPAP APAPPPALAR PRWDRPRWDS CDSLNGLDPS EKEKFSQMLI 
       610        620        630        640        650
VNEELQARLA QGRSGPSRAV PGPRAPEPQL SPGSDASEVR AWLQAKGFSS 
       660        670        680        690        700
GTVDALGVLT GAQLFSLQKE ELRAVSPEEG ARVYSQVTVQ RSLLEDKEKV 
       710        720 
SELEAVMEKQ KKKVEGEVEM EVI
Length:723
Mass (Da):80,251
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE55F71B6E128151E
GO
Isoform 2 (identifier: Q8TE68-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: Missing.
     128-143: ERAQPDVHFFQGLRLG → MNRTWPRRIWGSSQDE

Show »
Length:596
Mass (Da):66,477
Checksum:iCA417997A8419B8F
GO
Isoform 3 (identifier: Q8TE68-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MSTATGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVN → MGRKAIVLAIANTSLAFPLCQ
     451-451: R → RQVTQATQQGRGWEVRGRGRSAWPRLTRLSYFL
     509-696: DDSRKWWKVR...VTVQRSLLED → ED

Show »
Length:551
Mass (Da):61,682
Checksum:i39325B1AB8281946
GO
Isoform 4 (identifier: Q8TE68-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     178-187: QRDRSPAAET → MSPLSPGSPL
     191-300: QRRPSVRAVI...GRRSRRRAAG → ARADLTAILTGCPPLSACLVLAPRPHRRARLLPS
     451-451: R → RQVTQATQQGRGWEVRGRGRSAWPRLTRLSYFL

Show »
Length:502
Mass (Da):55,807
Checksum:i03BA1843CECD229A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EN83K7EN83_HUMAN
EPS8-like 1, isoform CRA_d
EPS8L1 hCG_20264
548Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DKV7B4DKV7_HUMAN
Epidermal growth factor receptor ki...
EPS8L1
659Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ELW3K7ELW3_HUMAN
Epidermal growth factor receptor ki...
EPS8L1
409Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKX9K7EKX9_HUMAN
Epidermal growth factor receptor ki...
EPS8L1
428Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG03038 differs from that shown. Reason: Frameshift.Curated
The sequence AAG03039 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti30M → T in BAC11399 (PubMed:14702039).Curated1
Sequence conflicti555P → S in AAL76117 (PubMed:12620401).Curated1
Sequence conflicti688T → I in BAA91041 (PubMed:14702039).Curated1
Sequence conflicti695E → G in BAC11399 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0603754A → T2 PublicationsCorresponds to variant dbSNP:rs12609976Ensembl.1
Natural variantiVAR_060376288R → G. Corresponds to variant dbSNP:rs1620074Ensembl.1
Natural variantiVAR_056870457Q → E2 PublicationsCorresponds to variant dbSNP:rs1628576Ensembl.1
Natural variantiVAR_060377669K → R3 PublicationsCorresponds to variant dbSNP:rs1054940Ensembl.1
Natural variantiVAR_061647703L → P. Corresponds to variant dbSNP:rs60073068Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0190821 – 177Missing in isoform 4. 1 PublicationAdd BLAST177
Alternative sequenceiVSP_0190831 – 127Missing in isoform 2. 2 PublicationsAdd BLAST127
Alternative sequenceiVSP_0190841 – 39MSTAT…QYPVN → MGRKAIVLAIANTSLAFPLC Q in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_019085128 – 143ERAQP…GLRLG → MNRTWPRRIWGSSQDE in isoform 2. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_019086178 – 187QRDRSPAAET → MSPLSPGSPL in isoform 4. 1 Publication10
Alternative sequenceiVSP_019087191 – 300QRRPS…RRAAG → ARADLTAILTGCPPLSACLV LAPRPHRRARLLPS in isoform 4. 1 PublicationAdd BLAST110
Alternative sequenceiVSP_019088451R → RQVTQATQQGRGWEVRGRGR SAWPRLTRLSYFL in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_019089509 – 696DDSRK…SLLED → ED in isoform 3. 1 PublicationAdd BLAST188

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF282168 Genomic DNA Translation: AAG03039.1 Sequence problems.
AF282167 mRNA Translation: AAG03038.1 Frameshift.
AY074928 mRNA Translation: AAL76117.1
AF370395 mRNA Translation: AAQ15231.1
AK000265 mRNA Translation: BAA91041.1
AK075098 mRNA Translation: BAC11399.1
AC005782 Genomic DNA No translation available.
AC011476 Genomic DNA No translation available.
BC004907 mRNA Translation: AAH04907.2
BC015763 mRNA Translation: AAH15763.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12914.1 [Q8TE68-1]
CCDS12915.1 [Q8TE68-2]

NCBI Reference Sequences

More...RefSeqi		NP_060199.3, NM_017729.3 [Q8TE68-2]
NP_573441.2, NM_133180.2 [Q8TE68-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000201647; ENSP00000201647; ENSG00000131037 [Q8TE68-1]
ENST00000245618; ENSP00000245618; ENSG00000131037 [Q8TE68-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		54869

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:54869

UCSC genome browser

More...UCSCi		uc002qis.5 human [Q8TE68-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF282168 Genomic DNA Translation: AAG03039.1 Sequence problems.
AF282167 mRNA Translation: AAG03038.1 Frameshift.
AY074928 mRNA Translation: AAL76117.1
AF370395 mRNA Translation: AAQ15231.1
AK000265 mRNA Translation: BAA91041.1
AK075098 mRNA Translation: BAC11399.1
AC005782 Genomic DNA No translation available.
AC011476 Genomic DNA No translation available.
BC004907 mRNA Translation: AAH04907.2
BC015763 mRNA Translation: AAH15763.1
CCDSiCCDS12914.1 [Q8TE68-1]
CCDS12915.1 [Q8TE68-2]
RefSeqiNP_060199.3, NM_017729.3 [Q8TE68-2]
NP_573441.2, NM_133180.2 [Q8TE68-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2K2MNMR-A481-536[»]
2ROLNMR-A478-537[»]
SMRiQ8TE68
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi120218, 12 interactors
CORUMiQ8TE68
IntActiQ8TE68, 8 interactors
MINTiQ8TE68
STRINGi9606.ENSP00000201647

PTM databases

iPTMnetiQ8TE68
PhosphoSitePlusiQ8TE68

Polymorphism and mutation databases

BioMutaiEPS8L1

Proteomic databases

EPDiQ8TE68
jPOSTiQ8TE68
MassIVEiQ8TE68
MaxQBiQ8TE68
PaxDbiQ8TE68
PeptideAtlasiQ8TE68
PRIDEiQ8TE68
ProteomicsDBi74407 [Q8TE68-1]
74408 [Q8TE68-2]
74409 [Q8TE68-3]
74410 [Q8TE68-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19481 151 antibodies

Genome annotation databases

EnsembliENST00000201647; ENSP00000201647; ENSG00000131037 [Q8TE68-1]
ENST00000245618; ENSP00000245618; ENSG00000131037 [Q8TE68-2]
GeneIDi54869
KEGGihsa:54869
UCSCiuc002qis.5 human [Q8TE68-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		54869

GeneCards: human genes, protein and diseases

More...GeneCardsi		EPS8L1
HGNCiHGNC:21295 EPS8L1
HPAiENSG00000131037 Tissue enhanced (esophagus, placenta)
MIMi614987 gene
neXtProtiNX_Q8TE68
OpenTargetsiENSG00000131037
PharmGKBiPA134990326

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IP0J Eukaryota
ENOG4111F7Z LUCA
GeneTreeiENSGT00940000158125
HOGENOMiCLU_014510_0_0_1
InParanoidiQ8TE68
KOiK17277
OMAiSQYLVNH
OrthoDBi218804at2759
PhylomeDBiQ8TE68
TreeFamiTF313069

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		EPS8L1 human
EvolutionaryTraceiQ8TE68

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		EPS8L1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		54869
PharosiQ8TE68 Tbio

Protein Ontology

More...PROi		PR:Q8TE68
RNActiQ8TE68 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000131037 Expressed in lower esophagus mucosa and 171 other tissues
ExpressionAtlasiQ8TE68 baseline and differential
GenevisibleiQ8TE68 HS

Family and domain databases

CDDicd01210 PTB_EPS8, 1 hit
cd11764 SH3_Eps8, 1 hit
Gene3Di1.10.150.50, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR039801 EPS8-like
IPR033928 EPS8_PTB
IPR035462 Eps8_SH3
IPR011993 PH-like_dom_sf
IPR013625 PTB
IPR006020 PTB/PI_dom
IPR013761 SAM/pointed_sf
IPR041418 SAM_3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR12287 PTHR12287, 1 hit
PfamiView protein in Pfam
PF08416 PTB, 1 hit
PF18016 SAM_3, 1 hit
PF00018 SH3_1, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiES8L1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TE68
Secondary accession number(s): Q71RE2
, Q8NC10, Q96BB7, Q9BSQ2, Q9GZQ2, Q9NXH0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: May 18, 2010
Last modified: April 22, 2020
This is version 146 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again