Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 153 (16 Oct 2019)
Sequence version 2 (17 Jan 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Pantothenate kinase 1

Gene

PANK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the physiological regulation of the intracellular CoA concentration.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Regulated by feedback inhibition by CoA and its thioesters. Strongly inhibited by acetyl-CoA and by manyl-CoA and also inhibited by high concentration of non-esterified CoA (CoASH) (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: coenzyme A biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes CoA from (R)-pantothenate.
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Pantothenate kinase 4 (PANK4), Pantothenate kinase 4, Pantothenate kinase 3 (PANK3), Pantothenate kinase 4 (PANK4), Pantothenate kinase 1 (PANK1), Pantothenate kinase 4 (PANK4), Pantothenate kinase 2, mitochondrial (PANK2), Pantothenate kinase 4
  2. Phosphopantothenate--cysteine ligase (PPCS)
  3. Phosphopantothenoylcysteine decarboxylase (PPCDC)
  4. Bifunctional coenzyme A synthase (COASY)
  5. Bifunctional coenzyme A synthase (COASY)
This subpathway is part of the pathway coenzyme A biosynthesis, which is itself part of Cofactor biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes CoA from (R)-pantothenate, the pathway coenzyme A biosynthesis and in Cofactor biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei417Acetyl-CoA1 Publication1
Binding sitei420Acetyl-CoA1 Publication1
Binding sitei432Acetyl-CoA1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
Biological processCoenzyme A biosynthesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS07852-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.1.33 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-196783 Coenzyme A biosynthesis

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00241;UER00352

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pantothenate kinase 1 (EC:2.7.1.33)
Short name:
hPanK
Short name:
hPanK1
Alternative name(s):
Pantothenic acid kinase 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PANK1
Synonyms:PANK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8598 PANK1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606160 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TE04

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
53354

Open Targets

More...
OpenTargetsi
ENSG00000152782

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA32928

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TE04

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3407326

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PANK1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
27805665

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001618021 – 598Pantothenate kinase 1Add BLAST598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei215PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TE04

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TE04

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TE04

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TE04

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TE04

PeptideAtlas

More...
PeptideAtlasi
Q8TE04

PRoteomics IDEntifications database

More...
PRIDEi
Q8TE04

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74385 [Q8TE04-1]
74386 [Q8TE04-2]
74387 [Q8TE04-3]
74388 [Q8TE04-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TE04

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TE04

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 1 is induced by bezafibrate, a hypolipidemic drug which acts as an agonist of peroxisome proliferator activator receptor alpha (PPARA), while isoform 2 levels decrease slightly.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000152782 Expressed in 182 organ(s), highest expression level in liver

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TE04 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119751, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TE04, 1 interactor

Molecular INTeraction database

More...
MINTi
Q8TE04

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000302108

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q8TE04

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1598
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TE04

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8TE04

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal extension, present in isoform 1 may be the regulatory domain.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the type II pantothenate kinase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2201 Eukaryota
COG5146 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157373

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000194690

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TE04

KEGG Orthology (KO)

More...
KOi
K09680

Identification of Orthologs from Complete Genome Data

More...
OMAi
FNGQPEC

Database of Orthologous Groups

More...
OrthoDBi
865329at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TE04

TreeFam database of animal gene trees

More...
TreeFami
TF314866

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004567 Type_II_PanK

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03630 Fumble, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00555 panK_eukar, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8TE04-1) [UniParc]FASTAAdd to basket
Also known as: PanK1-alpha, PANK1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLKLVGGGGG QDWACSVAGT SLGGEEAAFE VARPGDQGKA GGGSPGWGCA
60 70 80 90 100
GIPDSAPGAG VLQAGAVGPA RGGQGAEEVG ESAGGGEERR VRHPQAPALR
110 120 130 140 150
LLNRKPQGGS GEIKTPENDL QRGRLSRGPR TAPPAPGMGD RSGQQERSVP
160 170 180 190 200
HSPGAPVGTS AAAVNGLLHN GFHPPPVQPP HVCSRGPVGG SDAAPQRLPL
210 220 230 240 250
LPELQPQPLL PQHDSPAKKC RLRRRMDSGR KNRPPFPWFG MDIGGTLVKL
260 270 280 290 300
VYFEPKDITA EEEQEEVENL KSIRKYLTSN TAYGKTGIRD VHLELKNLTM
310 320 330 340 350
CGRKGNLHFI RFPSCAMHRF IQMGSEKNFS SLHTTLCATG GGAFKFEEDF
360 370 380 390 400
RMIADLQLHK LDELDCLIQG LLYVDSVGFN GKPECYYFEN PTNPELCQKK
410 420 430 440 450
PYCLDNPYPM LLVNMGSGVS ILAVYSKDNY KRVTGTSLGG GTFLGLCCLL
460 470 480 490 500
TGCETFEEAL EMAAKGDSTN VDKLVKDIYG GDYERFGLQG SAVASSFGNM
510 520 530 540 550
MSKEKRDSIS KEDLARATLV TITNNIGSIA RMCALNENID RVVFVGNFLR
560 570 580 590
INMVSMKLLA YAMDFWSKGQ LKALFLEHEG YFGAVGALLE LFKMTDDK
Length:598
Mass (Da):64,339
Last modified:January 17, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0A92115D5BEDFC4C
GO
Isoform 2 (identifier: Q8TE04-2) [UniParc]FASTAAdd to basket
Also known as: PANK1a, PanK1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT

Show »
Length:373
Mass (Da):41,671
Checksum:i6F7D73D40E15F0F5
GO
Isoform 3 (identifier: Q8TE04-3) [UniParc]FASTAAdd to basket
Also known as: PANK1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT
     438-496: Missing.

Show »
Length:314
Mass (Da):35,579
Checksum:i56D24B548DE056DE
GO
Isoform 4 (identifier: Q8TE04-4) [UniParc]FASTAAdd to basket
Also known as: PanK1-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-198: Missing.
     199-235: PLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPP → MAKSKHALLPFCHGMMQQEGLHQMQSLDLGLLSLQNS

Show »
Length:400
Mass (Da):44,634
Checksum:i9BA80EA526F43832
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH26296 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti306N → D in AAL86371 (PubMed:11809413).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0045201 – 235MLKLV…KNRPP → MKLINGKKQT in isoform 2 and isoform 3. 3 PublicationsAdd BLAST235
Alternative sequenceiVSP_0128231 – 198Missing in isoform 4. 1 PublicationAdd BLAST198
Alternative sequenceiVSP_012824199 – 235PLLPE…KNRPP → MAKSKHALLPFCHGMMQQEG LHQMQSLDLGLLSLQNS in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_004521438 – 496Missing in isoform 3. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF355198 mRNA Translation: AAL86371.1
AL157400 Genomic DNA No translation available.
AY027661 mRNA Translation: AAK20916.1
AY027662 mRNA Translation: AAK20917.1
AY027663 mRNA Translation: AAK20918.1
CH471066 Genomic DNA Translation: EAW50131.1
BC026296 mRNA Translation: AAH26296.1 Different initiation.
BK000008 mRNA Translation: DAA00002.1
BK000009 mRNA Translation: DAA00003.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31244.1 [Q8TE04-1]
CCDS7405.1 [Q8TE04-3]
CCDS7406.1 [Q8TE04-2]

NCBI Reference Sequences

More...
RefSeqi
NP_612189.2, NM_138316.3 [Q8TE04-3]
NP_683878.1, NM_148977.2 [Q8TE04-1]
NP_683879.1, NM_148978.2 [Q8TE04-2]
XP_016871822.1, XM_017016333.1 [Q8TE04-4]
XP_016871827.1, XM_017016338.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000307534; ENSP00000302108; ENSG00000152782 [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782 [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782 [Q8TE04-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
53354

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:53354

UCSC genome browser

More...
UCSCi
uc001kgn.3 human [Q8TE04-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF355198 mRNA Translation: AAL86371.1
AL157400 Genomic DNA No translation available.
AY027661 mRNA Translation: AAK20916.1
AY027662 mRNA Translation: AAK20917.1
AY027663 mRNA Translation: AAK20918.1
CH471066 Genomic DNA Translation: EAW50131.1
BC026296 mRNA Translation: AAH26296.1 Different initiation.
BK000008 mRNA Translation: DAA00002.1
BK000009 mRNA Translation: DAA00003.1
CCDSiCCDS31244.1 [Q8TE04-1]
CCDS7405.1 [Q8TE04-3]
CCDS7406.1 [Q8TE04-2]
RefSeqiNP_612189.2, NM_138316.3 [Q8TE04-3]
NP_683878.1, NM_148977.2 [Q8TE04-1]
NP_683879.1, NM_148978.2 [Q8TE04-2]
XP_016871822.1, XM_017016333.1 [Q8TE04-4]
XP_016871827.1, XM_017016338.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2I7NX-ray1.90A/B234-593[»]
3SMPX-ray1.90A/B231-597[»]
SMRiQ8TE04
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi119751, 3 interactors
IntActiQ8TE04, 1 interactor
MINTiQ8TE04
STRINGi9606.ENSP00000302108

Chemistry databases

BindingDBiQ8TE04
ChEMBLiCHEMBL3407326

PTM databases

iPTMnetiQ8TE04
PhosphoSitePlusiQ8TE04

Polymorphism and mutation databases

BioMutaiPANK1
DMDMi27805665

Proteomic databases

EPDiQ8TE04
jPOSTiQ8TE04
MassIVEiQ8TE04
MaxQBiQ8TE04
PaxDbiQ8TE04
PeptideAtlasiQ8TE04
PRIDEiQ8TE04
ProteomicsDBi74385 [Q8TE04-1]
74386 [Q8TE04-2]
74387 [Q8TE04-3]
74388 [Q8TE04-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
53354

Genome annotation databases

EnsembliENST00000307534; ENSP00000302108; ENSG00000152782 [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782 [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782 [Q8TE04-2]
GeneIDi53354
KEGGihsa:53354
UCSCiuc001kgn.3 human [Q8TE04-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
53354
DisGeNETi53354

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PANK1
HGNCiHGNC:8598 PANK1
MIMi606160 gene
neXtProtiNX_Q8TE04
OpenTargetsiENSG00000152782
PharmGKBiPA32928

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2201 Eukaryota
COG5146 LUCA
GeneTreeiENSGT00940000157373
HOGENOMiHOG000194690
InParanoidiQ8TE04
KOiK09680
OMAiFNGQPEC
OrthoDBi865329at2759
PhylomeDBiQ8TE04
TreeFamiTF314866

Enzyme and pathway databases

UniPathwayiUPA00241;UER00352
BioCyciMetaCyc:HS07852-MONOMER
BRENDAi2.7.1.33 2681
ReactomeiR-HSA-196783 Coenzyme A biosynthesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PANK1 human
EvolutionaryTraceiQ8TE04

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PANK1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
53354
PharosiQ8TE04

Protein Ontology

More...
PROi
PR:Q8TE04

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000152782 Expressed in 182 organ(s), highest expression level in liver
GenevisibleiQ8TE04 HS

Family and domain databases

InterProiView protein in InterPro
IPR004567 Type_II_PanK
PfamiView protein in Pfam
PF03630 Fumble, 1 hit
TIGRFAMsiTIGR00555 panK_eukar, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPANK1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TE04
Secondary accession number(s): A6NIP0
, Q7RTX6, Q7Z495, Q8TBQ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 17, 2003
Last modified: October 16, 2019
This is version 153 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again