Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pantothenate kinase 1

Gene

PANK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in the physiological regulation of the intracellular CoA concentration.By similarity

Catalytic activityi

ATP + (R)-pantothenate = ADP + (R)-4'-phosphopantothenate.

Activity regulationi

Regulated by feedback inhibition by CoA and its thioesters. Strongly inhibited by acetyl-CoA and by manyl-CoA and also inhibited by high concentration of non-esterified CoA (CoASH) (By similarity).By similarity

Pathwayi: coenzyme A biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes CoA from (R)-pantothenate.
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Pantothenate kinase 1 (PANK1), Pantothenate kinase 3 (PANK3), Pantothenate kinase 4 (PANK4), Pantothenate kinase 2, mitochondrial (PANK2), Pantothenate kinase 4 (PANK4), Pantothenate kinase 4, Pantothenate kinase 4
  2. Phosphopantothenate--cysteine ligase (PPCS)
  3. Phosphopantothenoylcysteine decarboxylase (PPCDC)
  4. Bifunctional coenzyme A synthase (COASY)
  5. Bifunctional coenzyme A synthase (COASY)
This subpathway is part of the pathway coenzyme A biosynthesis, which is itself part of Cofactor biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes CoA from (R)-pantothenate, the pathway coenzyme A biosynthesis and in Cofactor biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei417Acetyl-CoA1 Publication1
Binding sitei420Acetyl-CoA1 Publication1
Binding sitei432Acetyl-CoA1 Publication1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Transferase
Biological processCoenzyme A biosynthesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS07852-MONOMER
BRENDAi2.7.1.33 2681
ReactomeiR-HSA-196783 Coenzyme A biosynthesis
UniPathwayi
UPA00241;UER00352

Names & Taxonomyi

Protein namesi
Recommended name:
Pantothenate kinase 1 (EC:2.7.1.33)
Short name:
hPanK
Short name:
hPanK1
Alternative name(s):
Pantothenic acid kinase 1
Gene namesi
Name:PANK1
Synonyms:PANK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000152782.16
HGNCiHGNC:8598 PANK1
MIMi606160 gene
neXtProtiNX_Q8TE04

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi53354
OpenTargetsiENSG00000152782
PharmGKBiPA32928

Chemistry databases

ChEMBLiCHEMBL3407326

Polymorphism and mutation databases

BioMutaiPANK1
DMDMi27805665

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001618021 – 598Pantothenate kinase 1Add BLAST598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei215PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TE04
MaxQBiQ8TE04
PaxDbiQ8TE04
PeptideAtlasiQ8TE04
PRIDEiQ8TE04
ProteomicsDBi74385
74386 [Q8TE04-2]
74387 [Q8TE04-3]
74388 [Q8TE04-4]

PTM databases

iPTMnetiQ8TE04
PhosphoSitePlusiQ8TE04

Expressioni

Tissue specificityi

Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle.1 Publication

Inductioni

Isoform 1 is induced by bezafibrate, a hypolipidemic drug which acts as an agonist of peroxisome proliferator activator receptor alpha (PPARA), while isoform 2 levels decrease slightly.1 Publication

Gene expression databases

BgeeiENSG00000152782 Expressed in 182 organ(s), highest expression level in liver
CleanExiHS_PANK1
GenevisibleiQ8TE04 HS

Interactioni

Subunit structurei

Homodimer.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119751, 3 interactors
IntActiQ8TE04, 1 interactor
MINTiQ8TE04
STRINGi9606.ENSP00000302108

Chemistry databases

BindingDBiQ8TE04

Structurei

Secondary structure

1598
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8TE04
SMRiQ8TE04
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TE04

Family & Domainsi

Domaini

The N-terminal extension, present in isoform 1 may be the regulatory domain.

Sequence similaritiesi

Belongs to the type II pantothenate kinase family.Curated

Phylogenomic databases

eggNOGiKOG2201 Eukaryota
COG5146 LUCA
GeneTreeiENSGT00390000020719
HOGENOMiHOG000194690
HOVERGENiHBG053495
InParanoidiQ8TE04
KOiK09680
OMAiFNGQPEC
OrthoDBiEOG091G0851
PhylomeDBiQ8TE04
TreeFamiTF314866

Family and domain databases

InterProiView protein in InterPro
IPR004567 Type_II_PanK
PfamiView protein in Pfam
PF03630 Fumble, 1 hit
TIGRFAMsiTIGR00555 panK_eukar, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8TE04-1) [UniParc]FASTAAdd to basket
Also known as: PanK1-alpha, PANK1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLKLVGGGGG QDWACSVAGT SLGGEEAAFE VARPGDQGKA GGGSPGWGCA
60 70 80 90 100
GIPDSAPGAG VLQAGAVGPA RGGQGAEEVG ESAGGGEERR VRHPQAPALR
110 120 130 140 150
LLNRKPQGGS GEIKTPENDL QRGRLSRGPR TAPPAPGMGD RSGQQERSVP
160 170 180 190 200
HSPGAPVGTS AAAVNGLLHN GFHPPPVQPP HVCSRGPVGG SDAAPQRLPL
210 220 230 240 250
LPELQPQPLL PQHDSPAKKC RLRRRMDSGR KNRPPFPWFG MDIGGTLVKL
260 270 280 290 300
VYFEPKDITA EEEQEEVENL KSIRKYLTSN TAYGKTGIRD VHLELKNLTM
310 320 330 340 350
CGRKGNLHFI RFPSCAMHRF IQMGSEKNFS SLHTTLCATG GGAFKFEEDF
360 370 380 390 400
RMIADLQLHK LDELDCLIQG LLYVDSVGFN GKPECYYFEN PTNPELCQKK
410 420 430 440 450
PYCLDNPYPM LLVNMGSGVS ILAVYSKDNY KRVTGTSLGG GTFLGLCCLL
460 470 480 490 500
TGCETFEEAL EMAAKGDSTN VDKLVKDIYG GDYERFGLQG SAVASSFGNM
510 520 530 540 550
MSKEKRDSIS KEDLARATLV TITNNIGSIA RMCALNENID RVVFVGNFLR
560 570 580 590
INMVSMKLLA YAMDFWSKGQ LKALFLEHEG YFGAVGALLE LFKMTDDK
Length:598
Mass (Da):64,339
Last modified:January 17, 2003 - v2
Checksum:i0A92115D5BEDFC4C
GO
Isoform 2 (identifier: Q8TE04-2) [UniParc]FASTAAdd to basket
Also known as: PANK1a, PanK1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT

Show »
Length:373
Mass (Da):41,671
Checksum:i6F7D73D40E15F0F5
GO
Isoform 3 (identifier: Q8TE04-3) [UniParc]FASTAAdd to basket
Also known as: PANK1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT
     438-496: Missing.

Show »
Length:314
Mass (Da):35,579
Checksum:i56D24B548DE056DE
GO
Isoform 4 (identifier: Q8TE04-4) [UniParc]FASTAAdd to basket
Also known as: PanK1-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-198: Missing.
     199-235: PLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPP → MAKSKHALLPFCHGMMQQEGLHQMQSLDLGLLSLQNS

Show »
Length:400
Mass (Da):44,634
Checksum:i9BA80EA526F43832
GO

Sequence cautioni

The sequence AAH26296 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti306N → D in AAL86371 (PubMed:11809413).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0045201 – 235MLKLV…KNRPP → MKLINGKKQT in isoform 2 and isoform 3. 3 PublicationsAdd BLAST235
Alternative sequenceiVSP_0128231 – 198Missing in isoform 4. 1 PublicationAdd BLAST198
Alternative sequenceiVSP_012824199 – 235PLLPE…KNRPP → MAKSKHALLPFCHGMMQQEG LHQMQSLDLGLLSLQNS in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_004521438 – 496Missing in isoform 3. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF355198 mRNA Translation: AAL86371.1
AL157400 Genomic DNA No translation available.
AY027661 mRNA Translation: AAK20916.1
AY027662 mRNA Translation: AAK20917.1
AY027663 mRNA Translation: AAK20918.1
CH471066 Genomic DNA Translation: EAW50131.1
BC026296 mRNA Translation: AAH26296.1 Different initiation.
BK000008 mRNA Translation: DAA00002.1
BK000009 mRNA Translation: DAA00003.1
CCDSiCCDS31244.1 [Q8TE04-1]
CCDS7405.1 [Q8TE04-3]
CCDS7406.1 [Q8TE04-2]
RefSeqiNP_612189.2, NM_138316.3 [Q8TE04-3]
NP_683878.1, NM_148977.2 [Q8TE04-1]
NP_683879.1, NM_148978.2 [Q8TE04-2]
XP_016871822.1, XM_017016333.1 [Q8TE04-4]
XP_016871827.1, XM_017016338.1
UniGeneiHs.163555

Genome annotation databases

EnsembliENST00000307534; ENSP00000302108; ENSG00000152782 [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782 [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782 [Q8TE04-2]
GeneIDi53354
KEGGihsa:53354
UCSCiuc001kgn.3 human [Q8TE04-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF355198 mRNA Translation: AAL86371.1
AL157400 Genomic DNA No translation available.
AY027661 mRNA Translation: AAK20916.1
AY027662 mRNA Translation: AAK20917.1
AY027663 mRNA Translation: AAK20918.1
CH471066 Genomic DNA Translation: EAW50131.1
BC026296 mRNA Translation: AAH26296.1 Different initiation.
BK000008 mRNA Translation: DAA00002.1
BK000009 mRNA Translation: DAA00003.1
CCDSiCCDS31244.1 [Q8TE04-1]
CCDS7405.1 [Q8TE04-3]
CCDS7406.1 [Q8TE04-2]
RefSeqiNP_612189.2, NM_138316.3 [Q8TE04-3]
NP_683878.1, NM_148977.2 [Q8TE04-1]
NP_683879.1, NM_148978.2 [Q8TE04-2]
XP_016871822.1, XM_017016333.1 [Q8TE04-4]
XP_016871827.1, XM_017016338.1
UniGeneiHs.163555

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2I7NX-ray1.90A/B234-593[»]
3SMPX-ray1.90A/B231-597[»]
ProteinModelPortaliQ8TE04
SMRiQ8TE04
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119751, 3 interactors
IntActiQ8TE04, 1 interactor
MINTiQ8TE04
STRINGi9606.ENSP00000302108

Chemistry databases

BindingDBiQ8TE04
ChEMBLiCHEMBL3407326

PTM databases

iPTMnetiQ8TE04
PhosphoSitePlusiQ8TE04

Polymorphism and mutation databases

BioMutaiPANK1
DMDMi27805665

Proteomic databases

EPDiQ8TE04
MaxQBiQ8TE04
PaxDbiQ8TE04
PeptideAtlasiQ8TE04
PRIDEiQ8TE04
ProteomicsDBi74385
74386 [Q8TE04-2]
74387 [Q8TE04-3]
74388 [Q8TE04-4]

Protocols and materials databases

DNASUi53354
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307534; ENSP00000302108; ENSG00000152782 [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782 [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782 [Q8TE04-2]
GeneIDi53354
KEGGihsa:53354
UCSCiuc001kgn.3 human [Q8TE04-1]

Organism-specific databases

CTDi53354
DisGeNETi53354
EuPathDBiHostDB:ENSG00000152782.16
GeneCardsiPANK1
H-InvDBiHIX0009024
HGNCiHGNC:8598 PANK1
MIMi606160 gene
neXtProtiNX_Q8TE04
OpenTargetsiENSG00000152782
PharmGKBiPA32928
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2201 Eukaryota
COG5146 LUCA
GeneTreeiENSGT00390000020719
HOGENOMiHOG000194690
HOVERGENiHBG053495
InParanoidiQ8TE04
KOiK09680
OMAiFNGQPEC
OrthoDBiEOG091G0851
PhylomeDBiQ8TE04
TreeFamiTF314866

Enzyme and pathway databases

UniPathwayi
UPA00241;UER00352

BioCyciMetaCyc:HS07852-MONOMER
BRENDAi2.7.1.33 2681
ReactomeiR-HSA-196783 Coenzyme A biosynthesis

Miscellaneous databases

ChiTaRSiPANK1 human
EvolutionaryTraceiQ8TE04
GeneWikiiPANK1
GenomeRNAii53354
PROiPR:Q8TE04
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000152782 Expressed in 182 organ(s), highest expression level in liver
CleanExiHS_PANK1
GenevisibleiQ8TE04 HS

Family and domain databases

InterProiView protein in InterPro
IPR004567 Type_II_PanK
PfamiView protein in Pfam
PF03630 Fumble, 1 hit
TIGRFAMsiTIGR00555 panK_eukar, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPANK1_HUMAN
AccessioniPrimary (citable) accession number: Q8TE04
Secondary accession number(s): A6NIP0
, Q7RTX6, Q7Z495, Q8TBQ8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 17, 2003
Last modified: November 7, 2018
This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again