Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (11 Dec 2019)
Sequence version 3 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

CMRF35-like molecule 1

Gene

CD300LF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as an inhibitory receptor for myeloid cells and mast cells (PubMed:15549731). Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis (By similarity). Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands (PubMed:24035150). May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling (By similarity). Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:22043923). Inhibits osteoclast formation. Induces macrophage cell death upon engagement (By similarity).By similarity3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei205Phosphatase-binding1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processImmunity
LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CMRF35-like molecule 1
Short name:
CLM-1
Alternative name(s):
CD300 antigen-like family member F
Immune receptor expressed on myeloid cells 1
Short name:
IREM-1
Immunoglobulin superfamily member 13
Short name:
IgSF13
NK inhibitory receptor
CD_antigen: CD300f
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CD300LF
Synonyms:CD300F, CLM1, IGSF13, IREM1, NKIR
ORF Names:UNQ3105/PRO10111
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000186074.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29883 CD300LF

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609807 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TDQ1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 156ExtracellularSequence analysisAdd BLAST137
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Topological domaini178 – 290CytoplasmicSequence analysisAdd BLAST113

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi205Y → F: No interaction with PTPN6. 1 Publication1
Mutagenesisi249Y → F: Interaction with PTPN6. 1 Publication1
Mutagenesisi284Y → F: Interaction with PTPN6. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
146722

Open Targets

More...
OpenTargetsi
ENSG00000186074

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672153

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TDQ1 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CD300LF

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439398

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 191 PublicationAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024782520 – 290CMRF35-like molecule 1Add BLAST271

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi40 ↔ 108PROSITE-ProRule annotation1 Publication
Disulfide bondi54 ↔ 62PROSITE-ProRule annotation1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi88N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TDQ1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TDQ1

PeptideAtlas

More...
PeptideAtlasi
Q8TDQ1

PRoteomics IDEntifications database

More...
PRIDEi
Q8TDQ1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74321 [Q8TDQ1-1]
74322 [Q8TDQ1-2]
74323 [Q8TDQ1-3]
74324 [Q8TDQ1-4]
74325 [Q8TDQ1-5]
74326 [Q8TDQ1-6]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q8TDQ1-4 [Q8TDQ1-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TDQ1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TDQ1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186074 Expressed in 116 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TDQ1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TDQ1 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PTPN6/SHP-1 in a tyrosine phosphorylation dependent manner (PubMed:15184070, PubMed:15549731).

Interacts with IL4R (By similarity).

By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127005, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TDQ1, 2 interactors

Molecular INTeraction database

More...
MINTi
Q8TDQ1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000462309

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8TDQ1 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1290
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TDQ1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8TDQ1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 126Ig-like V-typeAdd BLAST107

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CD300 family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IZ4I Eukaryota
ENOG410YT8T LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154332

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TDQ1

KEGG Orthology (KO)

More...
KOi
K20395

Database of Orthologous Groups

More...
OrthoDBi
1494510at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TDQ1

TreeFam database of animal gene trees

More...
TreeFami
TF334441

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07686 V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TDQ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLLTLYLLL FWLSGYSIVT QITGPTTVNG LERGSLTVQC VYRSGWETYL
60 70 80 90 100
KWWCRGAIWR DCKILVKTSG SEQEVKRDRV SIKDNQKNRT FTVTMEDLMK
110 120 130 140 150
TDADTYWCGI EKTGNDLGVT VQVTIDPAPV TQEETSSSPT LTGHHLDNRH
160 170 180 190 200
KLLKLSVLLP LIFTILLLLL VAASLLAWRM MKYQQKAAGM SPEQVLQPLE
210 220 230 240 250
GDLCYADLTL QLAGTSPQKA TTKLSSAQVD QVEVEYVTMA SLPKEDISYA
260 270 280 290
SLTLGAEDQE PTYCNMGHLS SHLPGRGPEE PTEYSTISRP
Length:290
Mass (Da):32,335
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i27AA95664B82B945
GO
Isoform 2 (identifier: Q8TDQ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     128-128: A → ASTPAPTTPTSTTFTA
     187-221: AAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKAT → GTAAPGGRPLLCRPDPAAGRNLPAKGYHEAFLCPG
     222-290: Missing.

Show »
Length:239
Mass (Da):26,480
Checksum:iC67579996CFFA382
GO
Isoform 3 (identifier: Q8TDQ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     150-162: HKLLKLSVLLPLI → YCSPWRATSAMQT
     163-290: Missing.

Show »
Length:165
Mass (Da):18,684
Checksum:i8D46CA836B7E8AAE
GO
Isoform 4 (identifier: Q8TDQ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     149-191: RHKLLKLSVL...KYQQKAAGMS → SSRDVPRAGT...GYHEAFLCPG
     192-290: Missing.

Show »
Length:194
Mass (Da):21,427
Checksum:i9274E383F4A98236
GO
Isoform 5 (identifier: Q8TDQ1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-244: HKLLKLSVLL...EYVTMASLPK → SEGSQAANYR...GYHEAFLCPG
     245-290: Missing.

Show »
Length:244
Mass (Da):26,671
Checksum:i8CB8B81FCB47821A
GO
Isoform 6 (identifier: Q8TDQ1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ

Show »
Length:293
Mass (Da):32,628
Checksum:iC8AC14CA781BCFC4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KS52J3KS52_HUMAN
CMRF35-like molecule 1
CD300LF
305Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti37T → A in AAZ81566 (Ref. 5) Curated1
Sequence conflicti64I → V in AAZ81566 (Ref. 5) Curated1
Sequence conflicti78D → N in AAP42153 (PubMed:15549731).Curated1
Sequence conflicti135T → I in AAP42152 (PubMed:15549731).Curated1
Sequence conflicti138S → F in AAM19099 (PubMed:15184070).Curated1
Sequence conflicti212L → Q in AAP42152 (PubMed:15549731).Curated1
Sequence conflicti268H → R in AAP57942 (PubMed:15549731).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03912819V → A6 PublicationsCorresponds to variant dbSNP:rs35489971Ensembl.1
Natural variantiVAR_027152218Q → R4 PublicationsCorresponds to variant dbSNP:rs2034310Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0200561 – 14MPLLT…LFWLS → MWLPQLDLMRVISAKSQ in isoform 2, isoform 3, isoform 4 and isoform 6. 3 PublicationsAdd BLAST14
Alternative sequenceiVSP_020057128A → ASTPAPTTPTSTTFTA in isoform 2. 1 Publication1
Alternative sequenceiVSP_020058149 – 191RHKLL…AAGMS → SSRDVPRAGTAAPGGRPLLC RPDPAAGRNLPAKGYHEAFL CPG in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_020059150 – 244HKLLK…ASLPK → SEGSQAANYRPAAHQAQAPE AQCPPAPHLHHIAAAFGGRL TLGLEDDEVPAESSRDVPRA GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 5. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_020060150 – 162HKLLK…LLPLI → YCSPWRATSAMQT in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_020061163 – 290Missing in isoform 3. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_020062187 – 221AAGMS…PQKAT → GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_020063192 – 290Missing in isoform 4. 1 PublicationAdd BLAST99
Alternative sequenceiVSP_020064222 – 290Missing in isoform 2. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_020065245 – 290Missing in isoform 5. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF251706 mRNA Translation: AAM19099.1
AF375480 mRNA Translation: AAP42152.1
AF375481 mRNA Translation: AAP42153.1
AY303545 mRNA Translation: AAP57942.1
AY358545 mRNA Translation: AAQ88909.1
AK092757 mRNA Translation: BAC03966.1
AK315165 mRNA Translation: BAG37609.1
DQ153249 mRNA Translation: AAZ81566.1
AC016888 Genomic DNA No translation available.
AC064805 Genomic DNA No translation available.
BC028199 mRNA Translation: AAH28199.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11704.1 [Q8TDQ1-1]
CCDS74148.1 [Q8TDQ1-4]
CCDS74149.1 [Q8TDQ1-6]
CCDS74150.1 [Q8TDQ1-2]
CCDS74151.1 [Q8TDQ1-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001276011.1, NM_001289082.1 [Q8TDQ1-4]
NP_001276012.1, NM_001289083.1 [Q8TDQ1-5]
NP_001276013.1, NM_001289084.1
NP_001276014.1, NM_001289085.1 [Q8TDQ1-6]
NP_001276015.1, NM_001289086.1 [Q8TDQ1-2]
NP_001276016.1, NM_001289087.1
NP_620587.2, NM_139018.4 [Q8TDQ1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000301573; ENSP00000301573; ENSG00000186074 [Q8TDQ1-5]
ENST00000326165; ENSP00000327075; ENSG00000186074 [Q8TDQ1-1]
ENST00000343125; ENSP00000343751; ENSG00000186074 [Q8TDQ1-4]
ENST00000361254; ENSP00000355294; ENSG00000186074 [Q8TDQ1-2]
ENST00000462044; ENSP00000464223; ENSG00000186074 [Q8TDQ1-3]
ENST00000464910; ENSP00000464257; ENSG00000186074 [Q8TDQ1-6]
ENST00000469092; ENSP00000463743; ENSG00000186074 [Q8TDQ1-4]
ENST00000581500; ENSP00000464610; ENSG00000186074 [Q8TDQ1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
146722

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:146722

UCSC genome browser

More...
UCSCi
uc002jlg.5 human [Q8TDQ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251706 mRNA Translation: AAM19099.1
AF375480 mRNA Translation: AAP42152.1
AF375481 mRNA Translation: AAP42153.1
AY303545 mRNA Translation: AAP57942.1
AY358545 mRNA Translation: AAQ88909.1
AK092757 mRNA Translation: BAC03966.1
AK315165 mRNA Translation: BAG37609.1
DQ153249 mRNA Translation: AAZ81566.1
AC016888 Genomic DNA No translation available.
AC064805 Genomic DNA No translation available.
BC028199 mRNA Translation: AAH28199.1
CCDSiCCDS11704.1 [Q8TDQ1-1]
CCDS74148.1 [Q8TDQ1-4]
CCDS74149.1 [Q8TDQ1-6]
CCDS74150.1 [Q8TDQ1-2]
CCDS74151.1 [Q8TDQ1-5]
RefSeqiNP_001276011.1, NM_001289082.1 [Q8TDQ1-4]
NP_001276012.1, NM_001289083.1 [Q8TDQ1-5]
NP_001276013.1, NM_001289084.1
NP_001276014.1, NM_001289085.1 [Q8TDQ1-6]
NP_001276015.1, NM_001289086.1 [Q8TDQ1-2]
NP_001276016.1, NM_001289087.1
NP_620587.2, NM_139018.4 [Q8TDQ1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2NMSX-ray2.60A21-140[»]
SMRiQ8TDQ1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi127005, 2 interactors
IntActiQ8TDQ1, 2 interactors
MINTiQ8TDQ1
STRINGi9606.ENSP00000462309

PTM databases

iPTMnetiQ8TDQ1
PhosphoSitePlusiQ8TDQ1

Polymorphism and mutation databases

BioMutaiCD300LF
DMDMi296439398

Proteomic databases

MassIVEiQ8TDQ1
PaxDbiQ8TDQ1
PeptideAtlasiQ8TDQ1
PRIDEiQ8TDQ1
ProteomicsDBi74321 [Q8TDQ1-1]
74322 [Q8TDQ1-2]
74323 [Q8TDQ1-3]
74324 [Q8TDQ1-4]
74325 [Q8TDQ1-5]
74326 [Q8TDQ1-6]
TopDownProteomicsiQ8TDQ1-4 [Q8TDQ1-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
146722

Genome annotation databases

EnsembliENST00000301573; ENSP00000301573; ENSG00000186074 [Q8TDQ1-5]
ENST00000326165; ENSP00000327075; ENSG00000186074 [Q8TDQ1-1]
ENST00000343125; ENSP00000343751; ENSG00000186074 [Q8TDQ1-4]
ENST00000361254; ENSP00000355294; ENSG00000186074 [Q8TDQ1-2]
ENST00000462044; ENSP00000464223; ENSG00000186074 [Q8TDQ1-3]
ENST00000464910; ENSP00000464257; ENSG00000186074 [Q8TDQ1-6]
ENST00000469092; ENSP00000463743; ENSG00000186074 [Q8TDQ1-4]
ENST00000581500; ENSP00000464610; ENSG00000186074 [Q8TDQ1-2]
GeneIDi146722
KEGGihsa:146722
UCSCiuc002jlg.5 human [Q8TDQ1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
146722
DisGeNETi146722
EuPathDBiHostDB:ENSG00000186074.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CD300LF
HGNCiHGNC:29883 CD300LF
MIMi609807 gene
neXtProtiNX_Q8TDQ1
OpenTargetsiENSG00000186074
PharmGKBiPA142672153

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IZ4I Eukaryota
ENOG410YT8T LUCA
GeneTreeiENSGT00940000154332
InParanoidiQ8TDQ1
KOiK20395
OrthoDBi1494510at2759
PhylomeDBiQ8TDQ1
TreeFamiTF334441

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

EvolutionaryTraceiQ8TDQ1

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CD300LF

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
146722
PharosiQ8TDQ1 Tbio

Protein Ontology

More...
PROi
PR:Q8TDQ1
RNActiQ8TDQ1 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186074 Expressed in 116 organ(s), highest expression level in blood
ExpressionAtlasiQ8TDQ1 baseline and differential
GenevisibleiQ8TDQ1 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCLM1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TDQ1
Secondary accession number(s): B2RCL2
, C9JDN3, Q3Y6P0, Q6UX24, Q7Z6A6, Q7Z7I4, Q7Z7I5, Q8N6D0, Q8NAF5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: May 18, 2010
Last modified: December 11, 2019
This is version 140 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  7. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again