Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CMRF35-like molecule 1

Gene

CD300LF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as an inhibitory receptor for myeloid cells and mast cells (PubMed:15549731). Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis (By similarity). Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands (PubMed:24035150). May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling (By similarity). Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:22043923). Inhibits osteoclast formation. Induces macrophage cell death upon engagement (By similarity).By similarity3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei205Phosphatase-binding1

GO - Molecular functioni

  • ceramide binding Source: UniProtKB
  • interleukin-4 receptor binding Source: UniProtKB
  • phosphatidylserine binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processImmunity
LigandLipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Names & Taxonomyi

Protein namesi
Recommended name:
CMRF35-like molecule 1
Short name:
CLM-1
Alternative name(s):
CD300 antigen-like family member F
Immune receptor expressed on myeloid cells 1
Short name:
IREM-1
Immunoglobulin superfamily member 13
Short name:
IgSF13
NK inhibitory receptor
CD_antigen: CD300f
Gene namesi
Name:CD300LF
Synonyms:CD300F, CLM1, IGSF13, IREM1, NKIR
ORF Names:UNQ3105/PRO10111
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000186074.18
HGNCiHGNC:29883 CD300LF
MIMi609807 gene
neXtProtiNX_Q8TDQ1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 156ExtracellularSequence analysisAdd BLAST137
Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Topological domaini178 – 290CytoplasmicSequence analysisAdd BLAST113

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi205Y → F: No interaction with PTPN6. 1 Publication1
Mutagenesisi249Y → F: Interaction with PTPN6. 1 Publication1
Mutagenesisi284Y → F: Interaction with PTPN6. 1 Publication1

Organism-specific databases

DisGeNETi146722
OpenTargetsiENSG00000186074
PharmGKBiPA142672153

Polymorphism and mutation databases

BioMutaiCD300LF
DMDMi296439398

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 191 PublicationAdd BLAST19
ChainiPRO_000024782520 – 290CMRF35-like molecule 1Add BLAST271

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi40 ↔ 108PROSITE-ProRule annotation1 Publication
Disulfide bondi54 ↔ 62PROSITE-ProRule annotation1 Publication
Glycosylationi88N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

Phosphorylated on tyrosine.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ8TDQ1
PeptideAtlasiQ8TDQ1
PRIDEiQ8TDQ1
ProteomicsDBi74321
74322 [Q8TDQ1-2]
74323 [Q8TDQ1-3]
74324 [Q8TDQ1-4]
74325 [Q8TDQ1-5]
74326 [Q8TDQ1-6]
TopDownProteomicsiQ8TDQ1-4 [Q8TDQ1-4]

PTM databases

iPTMnetiQ8TDQ1
PhosphoSitePlusiQ8TDQ1

Expressioni

Tissue specificityi

Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.2 Publications

Gene expression databases

BgeeiENSG00000186074 Expressed in 116 organ(s), highest expression level in blood
ExpressionAtlasiQ8TDQ1 baseline and differential
GenevisibleiQ8TDQ1 HS

Interactioni

Subunit structurei

Interacts with PTPN6/SHP-1 in a tyrosine phosphorylation dependent manner (PubMed:15184070, PubMed:15549731). Interacts with IL4R (By similarity).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi127005, 1 interactor
IntActiQ8TDQ1, 2 interactors
MINTiQ8TDQ1
STRINGi9606.ENSP00000327075

Structurei

Secondary structure

1290
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8TDQ1
SMRiQ8TDQ1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TDQ1

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 126Ig-like V-typeAdd BLAST107

Sequence similaritiesi

Belongs to the CD300 family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IZ4I Eukaryota
ENOG410YT8T LUCA
GeneTreeiENSGT00470000042273
HOVERGENiHBG050999
InParanoidiQ8TDQ1
KOiK20395
PhylomeDBiQ8TDQ1
TreeFamiTF334441

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TDQ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLLTLYLLL FWLSGYSIVT QITGPTTVNG LERGSLTVQC VYRSGWETYL
60 70 80 90 100
KWWCRGAIWR DCKILVKTSG SEQEVKRDRV SIKDNQKNRT FTVTMEDLMK
110 120 130 140 150
TDADTYWCGI EKTGNDLGVT VQVTIDPAPV TQEETSSSPT LTGHHLDNRH
160 170 180 190 200
KLLKLSVLLP LIFTILLLLL VAASLLAWRM MKYQQKAAGM SPEQVLQPLE
210 220 230 240 250
GDLCYADLTL QLAGTSPQKA TTKLSSAQVD QVEVEYVTMA SLPKEDISYA
260 270 280 290
SLTLGAEDQE PTYCNMGHLS SHLPGRGPEE PTEYSTISRP
Length:290
Mass (Da):32,335
Last modified:May 18, 2010 - v3
Checksum:i27AA95664B82B945
GO
Isoform 2 (identifier: Q8TDQ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     128-128: A → ASTPAPTTPTSTTFTA
     187-221: AAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKAT → GTAAPGGRPLLCRPDPAAGRNLPAKGYHEAFLCPG
     222-290: Missing.

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):26,480
Checksum:iC67579996CFFA382
GO
Isoform 3 (identifier: Q8TDQ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     150-162: HKLLKLSVLLPLI → YCSPWRATSAMQT
     163-290: Missing.

Show »
Length:165
Mass (Da):18,684
Checksum:i8D46CA836B7E8AAE
GO
Isoform 4 (identifier: Q8TDQ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     149-191: RHKLLKLSVL...KYQQKAAGMS → SSRDVPRAGT...GYHEAFLCPG
     192-290: Missing.

Note: No experimental confirmation available.
Show »
Length:194
Mass (Da):21,427
Checksum:i9274E383F4A98236
GO
Isoform 5 (identifier: Q8TDQ1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-244: HKLLKLSVLL...EYVTMASLPK → SEGSQAANYR...GYHEAFLCPG
     245-290: Missing.

Note: No experimental confirmation available.
Show »
Length:244
Mass (Da):26,671
Checksum:i8CB8B81FCB47821A
GO
Isoform 6 (identifier: Q8TDQ1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ

Show »
Length:293
Mass (Da):32,628
Checksum:iC8AC14CA781BCFC4
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KS52J3KS52_HUMAN
CMRF35-like molecule 1
CD300LF
305Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti37T → A in AAZ81566 (Ref. 5) Curated1
Sequence conflicti64I → V in AAZ81566 (Ref. 5) Curated1
Sequence conflicti78D → N in AAP42153 (PubMed:15549731).Curated1
Sequence conflicti135T → I in AAP42152 (PubMed:15549731).Curated1
Sequence conflicti138S → F in AAM19099 (PubMed:15184070).Curated1
Sequence conflicti212L → Q in AAP42152 (PubMed:15549731).Curated1
Sequence conflicti268H → R in AAP57942 (PubMed:15549731).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03912819V → A6 PublicationsCorresponds to variant dbSNP:rs35489971Ensembl.1
Natural variantiVAR_027152218Q → R4 PublicationsCorresponds to variant dbSNP:rs2034310Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0200561 – 14MPLLT…LFWLS → MWLPQLDLMRVISAKSQ in isoform 2, isoform 3, isoform 4 and isoform 6. 3 PublicationsAdd BLAST14
Alternative sequenceiVSP_020057128A → ASTPAPTTPTSTTFTA in isoform 2. 1 Publication1
Alternative sequenceiVSP_020058149 – 191RHKLL…AAGMS → SSRDVPRAGTAAPGGRPLLC RPDPAAGRNLPAKGYHEAFL CPG in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_020059150 – 244HKLLK…ASLPK → SEGSQAANYRPAAHQAQAPE AQCPPAPHLHHIAAAFGGRL TLGLEDDEVPAESSRDVPRA GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 5. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_020060150 – 162HKLLK…LLPLI → YCSPWRATSAMQT in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_020061163 – 290Missing in isoform 3. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_020062187 – 221AAGMS…PQKAT → GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_020063192 – 290Missing in isoform 4. 1 PublicationAdd BLAST99
Alternative sequenceiVSP_020064222 – 290Missing in isoform 2. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_020065245 – 290Missing in isoform 5. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251706 mRNA Translation: AAM19099.1
AF375480 mRNA Translation: AAP42152.1
AF375481 mRNA Translation: AAP42153.1
AY303545 mRNA Translation: AAP57942.1
AY358545 mRNA Translation: AAQ88909.1
AK092757 mRNA Translation: BAC03966.1
AK315165 mRNA Translation: BAG37609.1
DQ153249 mRNA Translation: AAZ81566.1
AC016888 Genomic DNA No translation available.
AC064805 Genomic DNA No translation available.
BC028199 mRNA Translation: AAH28199.1
CCDSiCCDS11704.1 [Q8TDQ1-1]
CCDS74148.1 [Q8TDQ1-4]
CCDS74149.1 [Q8TDQ1-6]
CCDS74150.1 [Q8TDQ1-2]
CCDS74151.1 [Q8TDQ1-5]
RefSeqiNP_001276011.1, NM_001289082.1 [Q8TDQ1-4]
NP_001276012.1, NM_001289083.1 [Q8TDQ1-5]
NP_001276013.1, NM_001289084.1
NP_001276014.1, NM_001289085.1 [Q8TDQ1-6]
NP_001276015.1, NM_001289086.1 [Q8TDQ1-2]
NP_001276016.1, NM_001289087.1
NP_620587.2, NM_139018.4 [Q8TDQ1-1]
UniGeneiHs.567706

Genome annotation databases

EnsembliENST00000301573; ENSP00000301573; ENSG00000186074 [Q8TDQ1-5]
ENST00000326165; ENSP00000327075; ENSG00000186074 [Q8TDQ1-1]
ENST00000343125; ENSP00000343751; ENSG00000186074 [Q8TDQ1-4]
ENST00000361254; ENSP00000355294; ENSG00000186074 [Q8TDQ1-2]
ENST00000462044; ENSP00000464223; ENSG00000186074 [Q8TDQ1-3]
ENST00000464910; ENSP00000464257; ENSG00000186074 [Q8TDQ1-6]
ENST00000469092; ENSP00000463743; ENSG00000186074 [Q8TDQ1-4]
ENST00000581500; ENSP00000464610; ENSG00000186074 [Q8TDQ1-2]
GeneIDi146722
KEGGihsa:146722
UCSCiuc002jlg.5 human [Q8TDQ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251706 mRNA Translation: AAM19099.1
AF375480 mRNA Translation: AAP42152.1
AF375481 mRNA Translation: AAP42153.1
AY303545 mRNA Translation: AAP57942.1
AY358545 mRNA Translation: AAQ88909.1
AK092757 mRNA Translation: BAC03966.1
AK315165 mRNA Translation: BAG37609.1
DQ153249 mRNA Translation: AAZ81566.1
AC016888 Genomic DNA No translation available.
AC064805 Genomic DNA No translation available.
BC028199 mRNA Translation: AAH28199.1
CCDSiCCDS11704.1 [Q8TDQ1-1]
CCDS74148.1 [Q8TDQ1-4]
CCDS74149.1 [Q8TDQ1-6]
CCDS74150.1 [Q8TDQ1-2]
CCDS74151.1 [Q8TDQ1-5]
RefSeqiNP_001276011.1, NM_001289082.1 [Q8TDQ1-4]
NP_001276012.1, NM_001289083.1 [Q8TDQ1-5]
NP_001276013.1, NM_001289084.1
NP_001276014.1, NM_001289085.1 [Q8TDQ1-6]
NP_001276015.1, NM_001289086.1 [Q8TDQ1-2]
NP_001276016.1, NM_001289087.1
NP_620587.2, NM_139018.4 [Q8TDQ1-1]
UniGeneiHs.567706

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2NMSX-ray2.60A21-140[»]
ProteinModelPortaliQ8TDQ1
SMRiQ8TDQ1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127005, 1 interactor
IntActiQ8TDQ1, 2 interactors
MINTiQ8TDQ1
STRINGi9606.ENSP00000327075

PTM databases

iPTMnetiQ8TDQ1
PhosphoSitePlusiQ8TDQ1

Polymorphism and mutation databases

BioMutaiCD300LF
DMDMi296439398

Proteomic databases

PaxDbiQ8TDQ1
PeptideAtlasiQ8TDQ1
PRIDEiQ8TDQ1
ProteomicsDBi74321
74322 [Q8TDQ1-2]
74323 [Q8TDQ1-3]
74324 [Q8TDQ1-4]
74325 [Q8TDQ1-5]
74326 [Q8TDQ1-6]
TopDownProteomicsiQ8TDQ1-4 [Q8TDQ1-4]

Protocols and materials databases

DNASUi146722
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301573; ENSP00000301573; ENSG00000186074 [Q8TDQ1-5]
ENST00000326165; ENSP00000327075; ENSG00000186074 [Q8TDQ1-1]
ENST00000343125; ENSP00000343751; ENSG00000186074 [Q8TDQ1-4]
ENST00000361254; ENSP00000355294; ENSG00000186074 [Q8TDQ1-2]
ENST00000462044; ENSP00000464223; ENSG00000186074 [Q8TDQ1-3]
ENST00000464910; ENSP00000464257; ENSG00000186074 [Q8TDQ1-6]
ENST00000469092; ENSP00000463743; ENSG00000186074 [Q8TDQ1-4]
ENST00000581500; ENSP00000464610; ENSG00000186074 [Q8TDQ1-2]
GeneIDi146722
KEGGihsa:146722
UCSCiuc002jlg.5 human [Q8TDQ1-1]

Organism-specific databases

CTDi146722
DisGeNETi146722
EuPathDBiHostDB:ENSG00000186074.18
GeneCardsiCD300LF
H-InvDBiHIX0021633
HGNCiHGNC:29883 CD300LF
MIMi609807 gene
neXtProtiNX_Q8TDQ1
OpenTargetsiENSG00000186074
PharmGKBiPA142672153
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZ4I Eukaryota
ENOG410YT8T LUCA
GeneTreeiENSGT00470000042273
HOVERGENiHBG050999
InParanoidiQ8TDQ1
KOiK20395
PhylomeDBiQ8TDQ1
TreeFamiTF334441

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

EvolutionaryTraceiQ8TDQ1
GeneWikiiCD300LF
GenomeRNAii146722
PROiPR:Q8TDQ1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186074 Expressed in 116 organ(s), highest expression level in blood
ExpressionAtlasiQ8TDQ1 baseline and differential
GenevisibleiQ8TDQ1 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCLM1_HUMAN
AccessioniPrimary (citable) accession number: Q8TDQ1
Secondary accession number(s): B2RCL2
, C9JDN3, Q3Y6P0, Q6UX24, Q7Z6A6, Q7Z7I4, Q7Z7I5, Q8N6D0, Q8NAF5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: May 18, 2010
Last modified: September 12, 2018
This is version 133 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again