Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (07 Apr 2021)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Solute carrier family 2, facilitated glucose transporter member 14

Gene

SLC2A14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hexose transporter that can mediate the transport of glucose and dehydroascorbate across the cell membrane.1 Publication

Miscellaneous

GLUT14 is a recent (less than 5 M year old) duplication of GLUT3.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei339MonosaccharideBy similarity1
Binding sitei410MonosaccharideBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis, Sugar transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8TDB8

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-189200, Cellular hexose transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.1.1.90, the major facilitator superfamily (mfs)

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Solute carrier family 2, facilitated glucose transporter member 14Curated
Alternative name(s):
Glucose transporter type 141 Publication
Short name:
GLUT-141 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC2A141 PublicationImported
Synonyms:GLUT141 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18301, SLC2A14

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611039, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TDB8

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000173262.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 29CytoplasmicSequence analysisAdd BLAST29
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei30 – 50Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini51 – 88ExtracellularSequence analysisAdd BLAST38
Transmembranei89 – 109Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini110 – 117CytoplasmicSequence analysis8
Transmembranei118 – 138Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini139 – 148ExtracellularSequence analysis10
Transmembranei149 – 169Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini170 – 177CytoplasmicSequence analysis8
Transmembranei178 – 198Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini199 – 207ExtracellularSequence analysis9
Transmembranei208 – 228Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini229 – 293CytoplasmicSequence analysisAdd BLAST65
Transmembranei294 – 314Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini315 – 328ExtracellularSequence analysisAdd BLAST14
Transmembranei329 – 349Helical; Name=8Sequence analysisAdd BLAST21
Topological domaini350 – 358CytoplasmicSequence analysis9
Transmembranei359 – 379Helical; Name=9Sequence analysisAdd BLAST21
Topological domaini380 – 392ExtracellularSequence analysisAdd BLAST13
Transmembranei393 – 413Helical; Name=10Sequence analysisAdd BLAST21
Topological domaini414 – 423CytoplasmicSequence analysis10
Transmembranei424 – 444Helical; Name=11Sequence analysisAdd BLAST21
Topological domaini445 – 451ExtracellularSequence analysis7
Transmembranei452 – 472Helical; Name=12Sequence analysisAdd BLAST21
Topological domaini473 – 520CytoplasmicSequence analysisAdd BLAST48

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
144195

Open Targets

More...
OpenTargetsi
ENSG00000173262

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134885058

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TDB8, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4295906

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC2A14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
68565598

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000503811 – 520Solute carrier family 2, facilitated glucose transporter member 14Add BLAST520

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TDB8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TDB8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TDB8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TDB8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TDB8

PeptideAtlas

More...
PeptideAtlasi
Q8TDB8

PRoteomics IDEntifications database

More...
PRIDEi
Q8TDB8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
6924
7059
74258 [Q8TDB8-1]
74259 [Q8TDB8-2]
74260 [Q8TDB8-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8TDB8, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TDB8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TDB8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Mainly expressed in testis (PubMed:12504846, PubMed:27460888). Also expressed in small intestine, liver and kidney (PubMed:27460888).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000173262, Expressed in testis and 107 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TDB8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TDB8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000173262, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126837, 12 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TDB8, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000445929

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q8TDB8

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8TDB8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TDB8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni304 – 310Monosaccharide bindingBy similarity7

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0569, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162491

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001265_30_5_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TDB8

Identification of Orthologs from Complete Genome Data

More...
OMAi
DIKDMCE

Database of Orthologous Groups

More...
OrthoDBi
326501at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TDB8

TreeFam database of animal gene trees

More...
TreeFami
TF313762

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002945, Glc_transpt_3
IPR020846, MFS_dom
IPR005828, MFS_sugar_transport-like
IPR036259, MFS_trans_sf
IPR003663, Sugar/inositol_transpt
IPR005829, Sugar_transporter_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00083, Sugar_tr, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01192, GLUCTRSPORT3
PR00171, SUGRTRNSPORT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473, SSF103473, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00879, SP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50850, MFS, 1 hit
PS00216, SUGAR_TRANSPORT_1, 1 hit
PS00217, SUGAR_TRANSPORT_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TDB8-1) [UniParc]FASTAAdd to basket
Also known as: GLUT14-L1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEFHNGGHVS GIGGFLVSLT SRMKPHTLAV TPALIFAITV ATIGSFQFGY
60 70 80 90 100
NTGVINAPET IIKEFINKTL TDKANAPPSE VLLTNLWSLS VAIFSVGGMI
110 120 130 140 150
GSFSVGLFVN RFGRRNSMLI VNLLAATGGC LMGLCKIAES VEMLILGRLV
160 170 180 190 200
IGLFCGLCTG FVPMYIGEIS PTALRGAFGT LNQLGIVIGI LVAQIFGLEL
210 220 230 240 250
ILGSEELWPV LLGFTILPAI LQSAALPCCP ESPRFLLINR KKEENATRIL
260 270 280 290 300
QRLWGTQDVS QDIQEMKDES ARMSQEKQVT VLELFRVSSY RQPIIISIVL
310 320 330 340 350
QLSQQLSGIN AVFYYSTGIF KDAGVQQPIY ATISAGVVNT IFTLLSLFLV
360 370 380 390 400
ERAGRRTLHM IGLGGMAFCS TLMTVSLLLK NHYNGMSFVC IGAILVFVAC
410 420 430 440 450
FEIGPGPIPW FIVAELFSQG PRPAAMAVAG CSNWTSNFLV GLLFPSAAYY
460 470 480 490 500
LGAYVFIIFT GFLITFLAFT FFKVPETRGR TFEDITRAFE GQAHGADRSG
510 520
KDGVMGMNSI EPAKETTTNV
Length:520
Mass (Da):56,320
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEA304A5189087690
GO
Isoform 2 (identifier: Q8TDB8-2) [UniParc]FASTAAdd to basket
Also known as: GLUT14-S1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MDNRQN

Show »
Length:497
Mass (Da):54,015
Checksum:iFF6DF71A86A6E8A6
GO
Isoform 3 (identifier: Q8TDB8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.

Show »
Length:161
Mass (Da):17,378
Checksum:i9C169F3D73A4F34D
GO
Isoform 4 (identifier: Q8TDB8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MEFHNGGHVS...SVGLFVNRFG → MLLR

Show »
Length:411
Mass (Da):44,892
Checksum:iF36A98F338E85697
GO
Isoform 5 (identifier: Q8TDB8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEE

Show »
Length:535
Mass (Da):58,249
Checksum:i68FA09BC581B6156
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GXP8F5GXP8_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5Q3F5H5Q3_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H076F5H076_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6F6F5H6F6_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXP7F5GXP7_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5V7F5H5V7_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7N2F5H7N2_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXT4F5GXT4_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3J0F5H3J0_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
22Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H565F5H565_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
13Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti369C → G in AAQ63763 (Ref. 2) Curated1
Sequence conflicti376 – 377SL → PC in AAQ63763 (Ref. 2) Curated2
Sequence conflicti456F → L in CAB53739 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059852506G → E. Corresponds to variant dbSNP:rs10845981Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0144491 – 359Missing in isoform 3. 1 PublicationAdd BLAST359
Alternative sequenceiVSP_0552531 – 113MEFHN…VNRFG → MLLR in isoform 4. 1 PublicationAdd BLAST113
Alternative sequenceiVSP_0144501 – 29MEFHN…PHTLA → MDNRQN in isoform 2. 4 PublicationsAdd BLAST29
Alternative sequenceiVSP_0552541 – 29MEFHN…PHTLA → MQRLQLLRVEVLLGVKQGDE MRHFFFSSQTSTLEKSQNGG VGEE in isoform 5. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF481878 mRNA Translation: AAL89709.1
AF481879 mRNA Translation: AAL89710.1
AY357941 mRNA Translation: AAQ63763.1
AK122783 mRNA Translation: BAG53727.1
AK126026 mRNA Translation: BAG54279.1
AK302881 mRNA Translation: BAH13830.1
AK316238 mRNA Translation: BAH14609.1
AL110298 mRNA Translation: CAB53739.2
AC006517 Genomic DNA No translation available.
AC007536 Genomic DNA No translation available.
AC124891 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88652.1
CH471116 Genomic DNA Translation: EAW88653.1
BC060766 mRNA Translation: AAH60766.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS66300.1 [Q8TDB8-4]
CCDS66301.1 [Q8TDB8-2]
CCDS66302.1 [Q8TDB8-5]
CCDS8585.1 [Q8TDB8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001273162.1, NM_001286233.1 [Q8TDB8-1]
NP_001273163.1, NM_001286234.1 [Q8TDB8-2]
NP_001273164.1, NM_001286235.1 [Q8TDB8-2]
NP_001273165.1, NM_001286236.1 [Q8TDB8-4]
NP_001273166.1, NM_001286237.1 [Q8TDB8-5]
NP_703150.1, NM_153449.3 [Q8TDB8-1]
XP_005253372.1, XM_005253315.3 [Q8TDB8-2]
XP_005253374.1, XM_005253317.4 [Q8TDB8-2]
XP_011518864.1, XM_011520562.1 [Q8TDB8-2]
XP_011518865.1, XM_011520563.2 [Q8TDB8-2]
XP_011518866.1, XM_011520564.2 [Q8TDB8-4]
XP_011518867.1, XM_011520565.2 [Q8TDB8-4]
XP_016874335.1, XM_017018846.1 [Q8TDB8-2]
XP_016874336.1, XM_017018847.1 [Q8TDB8-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000340749; ENSP00000340450; ENSG00000173262 [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262 [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262 [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262 [Q8TDB8-4]
ENST00000539924; ENSP00000445929; ENSG00000173262 [Q8TDB8-5]
ENST00000542505; ENSP00000438484; ENSG00000173262 [Q8TDB8-3]
ENST00000542546; ENSP00000443903; ENSG00000173262 [Q8TDB8-4]
ENST00000543909; ENSP00000440480; ENSG00000173262 [Q8TDB8-1]
ENST00000616981; ENSP00000482927; ENSG00000173262 [Q8TDB8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
144195

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:144195

UCSC genome browser

More...
UCSCi
uc001qtk.5, human [Q8TDB8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF481878 mRNA Translation: AAL89709.1
AF481879 mRNA Translation: AAL89710.1
AY357941 mRNA Translation: AAQ63763.1
AK122783 mRNA Translation: BAG53727.1
AK126026 mRNA Translation: BAG54279.1
AK302881 mRNA Translation: BAH13830.1
AK316238 mRNA Translation: BAH14609.1
AL110298 mRNA Translation: CAB53739.2
AC006517 Genomic DNA No translation available.
AC007536 Genomic DNA No translation available.
AC124891 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88652.1
CH471116 Genomic DNA Translation: EAW88653.1
BC060766 mRNA Translation: AAH60766.1
CCDSiCCDS66300.1 [Q8TDB8-4]
CCDS66301.1 [Q8TDB8-2]
CCDS66302.1 [Q8TDB8-5]
CCDS8585.1 [Q8TDB8-1]
RefSeqiNP_001273162.1, NM_001286233.1 [Q8TDB8-1]
NP_001273163.1, NM_001286234.1 [Q8TDB8-2]
NP_001273164.1, NM_001286235.1 [Q8TDB8-2]
NP_001273165.1, NM_001286236.1 [Q8TDB8-4]
NP_001273166.1, NM_001286237.1 [Q8TDB8-5]
NP_703150.1, NM_153449.3 [Q8TDB8-1]
XP_005253372.1, XM_005253315.3 [Q8TDB8-2]
XP_005253374.1, XM_005253317.4 [Q8TDB8-2]
XP_011518864.1, XM_011520562.1 [Q8TDB8-2]
XP_011518865.1, XM_011520563.2 [Q8TDB8-2]
XP_011518866.1, XM_011520564.2 [Q8TDB8-4]
XP_011518867.1, XM_011520565.2 [Q8TDB8-4]
XP_016874335.1, XM_017018846.1 [Q8TDB8-2]
XP_016874336.1, XM_017018847.1 [Q8TDB8-2]

3D structure databases

SMRiQ8TDB8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi126837, 12 interactors
IntActiQ8TDB8, 7 interactors
STRINGi9606.ENSP00000445929

Chemistry databases

BindingDBiQ8TDB8
ChEMBLiCHEMBL4295906

Protein family/group databases

TCDBi2.A.1.1.90, the major facilitator superfamily (mfs)

PTM databases

GlyGeniQ8TDB8, 1 site
iPTMnetiQ8TDB8
PhosphoSitePlusiQ8TDB8

Genetic variation databases

BioMutaiSLC2A14
DMDMi68565598

Proteomic databases

EPDiQ8TDB8
jPOSTiQ8TDB8
MassIVEiQ8TDB8
MaxQBiQ8TDB8
PaxDbiQ8TDB8
PeptideAtlasiQ8TDB8
PRIDEiQ8TDB8
ProteomicsDBi6924
7059
74258 [Q8TDB8-1]
74259 [Q8TDB8-2]
74260 [Q8TDB8-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
53025, 49 antibodies

Genome annotation databases

EnsembliENST00000340749; ENSP00000340450; ENSG00000173262 [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262 [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262 [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262 [Q8TDB8-4]
ENST00000539924; ENSP00000445929; ENSG00000173262 [Q8TDB8-5]
ENST00000542505; ENSP00000438484; ENSG00000173262 [Q8TDB8-3]
ENST00000542546; ENSP00000443903; ENSG00000173262 [Q8TDB8-4]
ENST00000543909; ENSP00000440480; ENSG00000173262 [Q8TDB8-1]
ENST00000616981; ENSP00000482927; ENSG00000173262 [Q8TDB8-1]
GeneIDi144195
KEGGihsa:144195
UCSCiuc001qtk.5, human [Q8TDB8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
144195
DisGeNETi144195

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC2A14
HGNCiHGNC:18301, SLC2A14
HPAiENSG00000173262, Tissue enriched (testis)
MIMi611039, gene
neXtProtiNX_Q8TDB8
OpenTargetsiENSG00000173262
PharmGKBiPA134885058
VEuPathDBiHostDB:ENSG00000173262.11

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0569, Eukaryota
GeneTreeiENSGT00940000162491
HOGENOMiCLU_001265_30_5_1
InParanoidiQ8TDB8
OMAiDIKDMCE
OrthoDBi326501at2759
PhylomeDBiQ8TDB8
TreeFamiTF313762

Enzyme and pathway databases

PathwayCommonsiQ8TDB8
ReactomeiR-HSA-189200, Cellular hexose transport

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
144195, 4 hits in 929 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC2A14, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC2A14

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
144195
PharosiQ8TDB8, Tbio

Protein Ontology

More...
PROi
PR:Q8TDB8
RNActiQ8TDB8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000173262, Expressed in testis and 107 other tissues
ExpressionAtlasiQ8TDB8, baseline and differential
GenevisibleiQ8TDB8, HS

Family and domain databases

InterProiView protein in InterPro
IPR002945, Glc_transpt_3
IPR020846, MFS_dom
IPR005828, MFS_sugar_transport-like
IPR036259, MFS_trans_sf
IPR003663, Sugar/inositol_transpt
IPR005829, Sugar_transporter_CS
PfamiView protein in Pfam
PF00083, Sugar_tr, 1 hit
PRINTSiPR01192, GLUCTRSPORT3
PR00171, SUGRTRNSPORT
SUPFAMiSSF103473, SSF103473, 1 hit
TIGRFAMsiTIGR00879, SP, 1 hit
PROSITEiView protein in PROSITE
PS50850, MFS, 1 hit
PS00216, SUGAR_TRANSPORT_1, 1 hit
PS00217, SUGAR_TRANSPORT_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGTR14_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TDB8
Secondary accession number(s): B3KVB5
, B3KWW7, B7Z844, B7ZAC3, Q6UY84, Q8TDB9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: June 1, 2002
Last modified: April 7, 2021
This is version 157 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again