Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 2, facilitated glucose transporter member 14

Gene

SLC2A14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Facilitative glucose transporter (By similarity). May have a specific function related to spermatogenesis.By similarity

Miscellaneous

GLUT14 is a recent (less than 5 M year old) duplication of GLUT3.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei339MonosaccharideBy similarity1
Binding sitei410MonosaccharideBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis, Sugar transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-189200 Cellular hexose transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.1.1.90 the major facilitator superfamily (mfs)

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Solute carrier family 2, facilitated glucose transporter member 14
Alternative name(s):
Glucose transporter type 14
Short name:
GLUT-14
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC2A14
Synonyms:GLUT14, GLUT3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000173262.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18301 SLC2A14

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611039 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TDB8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 29CytoplasmicSequence analysisAdd BLAST29
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei30 – 50Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini51 – 88ExtracellularSequence analysisAdd BLAST38
Transmembranei89 – 109Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini110 – 117CytoplasmicSequence analysis8
Transmembranei118 – 138Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini139 – 148ExtracellularSequence analysis10
Transmembranei149 – 169Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini170 – 177CytoplasmicSequence analysis8
Transmembranei178 – 198Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini199 – 207ExtracellularSequence analysis9
Transmembranei208 – 228Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini229 – 293CytoplasmicSequence analysisAdd BLAST65
Transmembranei294 – 314Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini315 – 328ExtracellularSequence analysisAdd BLAST14
Transmembranei329 – 349Helical; Name=8Sequence analysisAdd BLAST21
Topological domaini350 – 358CytoplasmicSequence analysis9
Transmembranei359 – 379Helical; Name=9Sequence analysisAdd BLAST21
Topological domaini380 – 392ExtracellularSequence analysisAdd BLAST13
Transmembranei393 – 413Helical; Name=10Sequence analysisAdd BLAST21
Topological domaini414 – 423CytoplasmicSequence analysis10
Transmembranei424 – 444Helical; Name=11Sequence analysisAdd BLAST21
Topological domaini445 – 451ExtracellularSequence analysis7
Transmembranei452 – 472Helical; Name=12Sequence analysisAdd BLAST21
Topological domaini473 – 520CytoplasmicSequence analysisAdd BLAST48

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
144195

Open Targets

More...
OpenTargetsi
ENSG00000173262

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134885058

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC2A14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
68565598

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000503811 – 520Solute carrier family 2, facilitated glucose transporter member 14Add BLAST520

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TDB8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TDB8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TDB8

PeptideAtlas

More...
PeptideAtlasi
Q8TDB8

PRoteomics IDEntifications database

More...
PRIDEi
Q8TDB8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74258
74259 [Q8TDB8-2]
74260 [Q8TDB8-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TDB8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TDB8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed mainly in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000173262 Expressed in 82 organ(s), highest expression level in right testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_SLC2A14

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TDB8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TDB8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA006539

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126837, 11 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000379834

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8TDB8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TDB8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni304 – 310Monosaccharide bindingBy similarity7

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0569 Eukaryota
COG0477 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162491

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000202871

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG014816

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TDB8

Identification of Orthologs from Complete Genome Data

More...
OMAi
PRIYLDS

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0A9K

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TDB8

TreeFam database of animal gene trees

More...
TreeFami
TF313762

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06174 MFS, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002945 Glc_transpt_3
IPR020846 MFS_dom
IPR005828 MFS_sugar_transport-like
IPR036259 MFS_trans_sf
IPR003663 Sugar/inositol_transpt
IPR005829 Sugar_transporter_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00083 Sugar_tr, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01192 GLUCTRSPORT3
PR00171 SUGRTRNSPORT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473 SSF103473, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00879 SP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50850 MFS, 1 hit
PS00216 SUGAR_TRANSPORT_1, 1 hit
PS00217 SUGAR_TRANSPORT_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TDB8-1) [UniParc]FASTAAdd to basket
Also known as: GLUT14-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEFHNGGHVS GIGGFLVSLT SRMKPHTLAV TPALIFAITV ATIGSFQFGY
60 70 80 90 100
NTGVINAPET IIKEFINKTL TDKANAPPSE VLLTNLWSLS VAIFSVGGMI
110 120 130 140 150
GSFSVGLFVN RFGRRNSMLI VNLLAATGGC LMGLCKIAES VEMLILGRLV
160 170 180 190 200
IGLFCGLCTG FVPMYIGEIS PTALRGAFGT LNQLGIVIGI LVAQIFGLEL
210 220 230 240 250
ILGSEELWPV LLGFTILPAI LQSAALPCCP ESPRFLLINR KKEENATRIL
260 270 280 290 300
QRLWGTQDVS QDIQEMKDES ARMSQEKQVT VLELFRVSSY RQPIIISIVL
310 320 330 340 350
QLSQQLSGIN AVFYYSTGIF KDAGVQQPIY ATISAGVVNT IFTLLSLFLV
360 370 380 390 400
ERAGRRTLHM IGLGGMAFCS TLMTVSLLLK NHYNGMSFVC IGAILVFVAC
410 420 430 440 450
FEIGPGPIPW FIVAELFSQG PRPAAMAVAG CSNWTSNFLV GLLFPSAAYY
460 470 480 490 500
LGAYVFIIFT GFLITFLAFT FFKVPETRGR TFEDITRAFE GQAHGADRSG
510 520
KDGVMGMNSI EPAKETTTNV
Length:520
Mass (Da):56,320
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEA304A5189087690
GO
Isoform 2 (identifier: Q8TDB8-2) [UniParc]FASTAAdd to basket
Also known as: GLUT14-S

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MDNRQN

Show »
Length:497
Mass (Da):54,015
Checksum:iFF6DF71A86A6E8A6
GO
Isoform 3 (identifier: Q8TDB8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.

Note: No experimental confirmation available.
Show »
Length:161
Mass (Da):17,378
Checksum:i9C169F3D73A4F34D
GO
Isoform 4 (identifier: Q8TDB8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MEFHNGGHVS...SVGLFVNRFG → MLLR

Note: No experimental confirmation available.
Show »
Length:411
Mass (Da):44,892
Checksum:iF36A98F338E85697
GO
Isoform 5 (identifier: Q8TDB8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEE

Note: No experimental confirmation available.
Show »
Length:535
Mass (Da):58,249
Checksum:i68FA09BC581B6156
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H076F5H076_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXP8F5GXP8_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXP7F5GXP7_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6F6F5H6F6_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5Q3F5H5Q3_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5V7F5H5V7_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7N2F5H7N2_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXT4F5GXT4_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3J0F5H3J0_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
22Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H565F5H565_HUMAN
Solute carrier family 2, facilitate...
SLC2A14
13Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti369C → G in AAQ63763 (Ref. 2) Curated1
Sequence conflicti376 – 377SL → PC in AAQ63763 (Ref. 2) Curated2
Sequence conflicti456F → L in CAB53739 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059852506G → E. Corresponds to variant dbSNP:rs10845981Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0144491 – 359Missing in isoform 3. 1 PublicationAdd BLAST359
Alternative sequenceiVSP_0552531 – 113MEFHN…VNRFG → MLLR in isoform 4. 1 PublicationAdd BLAST113
Alternative sequenceiVSP_0144501 – 29MEFHN…PHTLA → MDNRQN in isoform 2. 4 PublicationsAdd BLAST29
Alternative sequenceiVSP_0552541 – 29MEFHN…PHTLA → MQRLQLLRVEVLLGVKQGDE MRHFFFSSQTSTLEKSQNGG VGEE in isoform 5. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF481878 mRNA Translation: AAL89709.1
AF481879 mRNA Translation: AAL89710.1
AY357941 mRNA Translation: AAQ63763.1
AK122783 mRNA Translation: BAG53727.1
AK126026 mRNA Translation: BAG54279.1
AK302881 mRNA Translation: BAH13830.1
AK316238 mRNA Translation: BAH14609.1
AL110298 mRNA Translation: CAB53739.2
AC006517 Genomic DNA No translation available.
AC007536 Genomic DNA No translation available.
AC124891 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88652.1
CH471116 Genomic DNA Translation: EAW88653.1
BC060766 mRNA Translation: AAH60766.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS66300.1 [Q8TDB8-4]
CCDS66301.1 [Q8TDB8-2]
CCDS66302.1 [Q8TDB8-5]
CCDS8585.1 [Q8TDB8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001273162.1, NM_001286233.1 [Q8TDB8-1]
NP_001273163.1, NM_001286234.1 [Q8TDB8-2]
NP_001273164.1, NM_001286235.1 [Q8TDB8-2]
NP_001273165.1, NM_001286236.1 [Q8TDB8-4]
NP_001273166.1, NM_001286237.1 [Q8TDB8-5]
NP_703150.1, NM_153449.3 [Q8TDB8-1]
XP_005253372.1, XM_005253315.3 [Q8TDB8-2]
XP_005253374.1, XM_005253317.4 [Q8TDB8-2]
XP_011518864.1, XM_011520562.1 [Q8TDB8-2]
XP_011518865.1, XM_011520563.2 [Q8TDB8-2]
XP_011518866.1, XM_011520564.2 [Q8TDB8-4]
XP_011518867.1, XM_011520565.2 [Q8TDB8-4]
XP_016874335.1, XM_017018846.1 [Q8TDB8-2]
XP_016874336.1, XM_017018847.1 [Q8TDB8-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.655169
Hs.739527

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000340749; ENSP00000340450; ENSG00000173262 [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262 [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262 [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262 [Q8TDB8-4]
ENST00000539924; ENSP00000445929; ENSG00000173262 [Q8TDB8-5]
ENST00000542505; ENSP00000438484; ENSG00000173262 [Q8TDB8-3]
ENST00000542546; ENSP00000443903; ENSG00000173262 [Q8TDB8-4]
ENST00000543909; ENSP00000440480; ENSG00000173262 [Q8TDB8-1]
ENST00000616981; ENSP00000482927; ENSG00000173262 [Q8TDB8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
144195

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:144195

UCSC genome browser

More...
UCSCi
uc001qtk.5 human [Q8TDB8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF481878 mRNA Translation: AAL89709.1
AF481879 mRNA Translation: AAL89710.1
AY357941 mRNA Translation: AAQ63763.1
AK122783 mRNA Translation: BAG53727.1
AK126026 mRNA Translation: BAG54279.1
AK302881 mRNA Translation: BAH13830.1
AK316238 mRNA Translation: BAH14609.1
AL110298 mRNA Translation: CAB53739.2
AC006517 Genomic DNA No translation available.
AC007536 Genomic DNA No translation available.
AC124891 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88652.1
CH471116 Genomic DNA Translation: EAW88653.1
BC060766 mRNA Translation: AAH60766.1
CCDSiCCDS66300.1 [Q8TDB8-4]
CCDS66301.1 [Q8TDB8-2]
CCDS66302.1 [Q8TDB8-5]
CCDS8585.1 [Q8TDB8-1]
RefSeqiNP_001273162.1, NM_001286233.1 [Q8TDB8-1]
NP_001273163.1, NM_001286234.1 [Q8TDB8-2]
NP_001273164.1, NM_001286235.1 [Q8TDB8-2]
NP_001273165.1, NM_001286236.1 [Q8TDB8-4]
NP_001273166.1, NM_001286237.1 [Q8TDB8-5]
NP_703150.1, NM_153449.3 [Q8TDB8-1]
XP_005253372.1, XM_005253315.3 [Q8TDB8-2]
XP_005253374.1, XM_005253317.4 [Q8TDB8-2]
XP_011518864.1, XM_011520562.1 [Q8TDB8-2]
XP_011518865.1, XM_011520563.2 [Q8TDB8-2]
XP_011518866.1, XM_011520564.2 [Q8TDB8-4]
XP_011518867.1, XM_011520565.2 [Q8TDB8-4]
XP_016874335.1, XM_017018846.1 [Q8TDB8-2]
XP_016874336.1, XM_017018847.1 [Q8TDB8-2]
UniGeneiHs.655169
Hs.739527

3D structure databases

ProteinModelPortaliQ8TDB8
SMRiQ8TDB8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126837, 11 interactors
STRINGi9606.ENSP00000379834

Protein family/group databases

TCDBi2.A.1.1.90 the major facilitator superfamily (mfs)

PTM databases

iPTMnetiQ8TDB8
PhosphoSitePlusiQ8TDB8

Polymorphism and mutation databases

BioMutaiSLC2A14
DMDMi68565598

Proteomic databases

EPDiQ8TDB8
MaxQBiQ8TDB8
PaxDbiQ8TDB8
PeptideAtlasiQ8TDB8
PRIDEiQ8TDB8
ProteomicsDBi74258
74259 [Q8TDB8-2]
74260 [Q8TDB8-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340749; ENSP00000340450; ENSG00000173262 [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262 [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262 [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262 [Q8TDB8-4]
ENST00000539924; ENSP00000445929; ENSG00000173262 [Q8TDB8-5]
ENST00000542505; ENSP00000438484; ENSG00000173262 [Q8TDB8-3]
ENST00000542546; ENSP00000443903; ENSG00000173262 [Q8TDB8-4]
ENST00000543909; ENSP00000440480; ENSG00000173262 [Q8TDB8-1]
ENST00000616981; ENSP00000482927; ENSG00000173262 [Q8TDB8-1]
GeneIDi144195
KEGGihsa:144195
UCSCiuc001qtk.5 human [Q8TDB8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
144195
DisGeNETi144195
EuPathDBiHostDB:ENSG00000173262.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC2A14
HGNCiHGNC:18301 SLC2A14
HPAiHPA006539
MIMi611039 gene
neXtProtiNX_Q8TDB8
OpenTargetsiENSG00000173262
PharmGKBiPA134885058

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0569 Eukaryota
COG0477 LUCA
GeneTreeiENSGT00940000162491
HOGENOMiHOG000202871
HOVERGENiHBG014816
InParanoidiQ8TDB8
OMAiPRIYLDS
OrthoDBiEOG091G0A9K
PhylomeDBiQ8TDB8
TreeFamiTF313762

Enzyme and pathway databases

ReactomeiR-HSA-189200 Cellular hexose transport

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC2A14 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC2A14

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
144195

Protein Ontology

More...
PROi
PR:Q8TDB8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000173262 Expressed in 82 organ(s), highest expression level in right testis
CleanExiHS_SLC2A14
ExpressionAtlasiQ8TDB8 baseline and differential
GenevisibleiQ8TDB8 HS

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR002945 Glc_transpt_3
IPR020846 MFS_dom
IPR005828 MFS_sugar_transport-like
IPR036259 MFS_trans_sf
IPR003663 Sugar/inositol_transpt
IPR005829 Sugar_transporter_CS
PfamiView protein in Pfam
PF00083 Sugar_tr, 1 hit
PRINTSiPR01192 GLUCTRSPORT3
PR00171 SUGRTRNSPORT
SUPFAMiSSF103473 SSF103473, 1 hit
TIGRFAMsiTIGR00879 SP, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit
PS00216 SUGAR_TRANSPORT_1, 1 hit
PS00217 SUGAR_TRANSPORT_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGTR14_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TDB8
Secondary accession number(s): B3KVB5
, B3KWW7, B7Z844, B7ZAC3, Q6UY84, Q8TDB9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: June 1, 2002
Last modified: December 5, 2018
This is version 140 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again