Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (23 Feb 2022)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Dynein axonemal heavy chain 3

Gene

DNAH3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly (By similarity).

By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi1429 – 1436ATPSequence analysis8
Nucleotide bindingi1710 – 1717ATPSequence analysis8
Nucleotide bindingi2074 – 2081ATPSequence analysis8
Nucleotide bindingi2434 – 2441ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8TD57

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8TD57

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dynein axonemal heavy chain 3
Alternative name(s):
Axonemal beta dynein heavy chain 3
Short name:
HsADHC3
Ciliary dynein heavy chain 3
Dnahc3-b
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DNAH3
Synonyms:DNAHC3B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2949, DNAH3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603334, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TD57

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000158486

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55567

Open Targets

More...
OpenTargetsi
ENSG00000158486

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27402

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TD57, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DNAH3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762616

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003225441 – 4116Dynein axonemal heavy chain 3Add BLAST4116

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TD57

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TD57

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TD57

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TD57

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TD57

PeptideAtlas

More...
PeptideAtlasi
Q8TD57

PRoteomics IDEntifications database

More...
PRIDEi
Q8TD57

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74244 [Q8TD57-1]
74245 [Q8TD57-2]
74246 [Q8TD57-3]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q8TD57

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8TD57, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TD57

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TD57

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed primarily in trachea and testis, 2 tissues containing axonemal structures. Also expressed in lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000158486, Expressed in epithelium of bronchus and 135 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TD57, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000158486, Tissue enhanced (brain, fallopian tube, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Consists of at least two heavy chains and a number of intermediate and light chains.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120722, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TD57, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000261383

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8TD57, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TD57

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 1390StemBy similarityAdd BLAST1390
Regioni1 – 68DisorderedSequence analysisAdd BLAST68
Regioni137 – 172DisorderedSequence analysisAdd BLAST36
Regioni1391 – 1612AAA 1By similarityAdd BLAST222
Regioni1672 – 1903AAA 2By similarityAdd BLAST232
Regioni2036 – 2284AAA 3By similarityAdd BLAST249
Regioni2395 – 2646AAA 4By similarityAdd BLAST252
Regioni2661 – 2960StalkBy similarityAdd BLAST300
Regioni3045 – 3275AAA 5By similarityAdd BLAST231
Regioni3488 – 3712AAA 6By similarityAdd BLAST225

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili785 – 852Sequence analysisAdd BLAST68

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi26 – 41Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi137 – 155Polar residuesSequence analysisAdd BLAST19
Compositional biasi156 – 172Basic and acidic residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the dynein heavy chain family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3595, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154959

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000038_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TD57

Identification of Orthologs from Complete Genome Data

More...
OMAi
FFQSCAK

Database of Orthologous Groups

More...
OrthoDBi
2079at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TD57

TreeFam database of animal gene trees

More...
TreeFami
TF316836

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.8.710, 1 hit
1.10.8.720, 1 hit
1.20.140.100, 1 hit
3.10.490.20, 1 hit
3.20.180.20, 1 hit
3.40.50.300, 5 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593, AAA+_ATPase
IPR035699, AAA_6
IPR035706, AAA_9
IPR041658, AAA_lid_11
IPR042219, AAA_lid_11_sf
IPR026983, DHC_fam
IPR041589, DNAH3_AAA_lid_1
IPR042222, Dynein_2_N
IPR043157, Dynein_AAA1S
IPR041466, Dynein_AAA5_ext
IPR041228, Dynein_C
IPR043160, Dynein_C_barrel
IPR024743, Dynein_HC_stalk
IPR024317, Dynein_heavy_chain_D4_dom
IPR004273, Dynein_heavy_D6_P-loop
IPR013602, Dynein_heavy_linker
IPR042228, Dynein_linker_3
IPR027417, P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR10676, PTHR10676, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12774, AAA_6, 1 hit
PF12780, AAA_8, 1 hit
PF12781, AAA_9, 1 hit
PF17857, AAA_lid_1, 1 hit
PF18198, AAA_lid_11, 1 hit
PF08393, DHC_N2, 1 hit
PF17852, Dynein_AAA_lid, 1 hit
PF18199, Dynein_C, 1 hit
PF03028, Dynein_heavy, 1 hit
PF12777, MT, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382, AAA, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8TD57-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGATGRLELT LAAPPHPGPA FQRSKARETQ GEEEGSEMQI AKSDSIHHMS
60 70 80 90 100
HSQGQPELPP LPASANEEPS GLYQTVMSHS FYPPLMQRTS WTLAAPFKEQ
110 120 130 140 150
HHHRGPSDSI ANNYSLMAQD LKLKDLLKVY QPATISVPRD RTGQGLPSSG
160 170 180 190 200
NRSSSEPMRK KTKFSSRNKE DSTRIKLAFK TSIFSPMKKE VKTSLTFPGS
210 220 230 240 250
RPMSPEQQLD VMLQQEMEME SKEKKPSESD LERYYYYLTN GIRKDMIAPE
260 270 280 290 300
EGEVMVRISK LISNTLLTSP FLEPLMVVLV QEKENDYYCS LMKSIVDYIL
310 320 330 340 350
MDPMERKRLF IESIPRLFPQ RVIRAPVPWH SVYRSAKKWN EEHLHTVNPM
360 370 380 390 400
MLRLKELWFA EFRDLRFVRT AEILAGKLPL QPQEFWDVIQ KHCLEAHQTL
410 420 430 440 450
LNKWIPTCAQ LFTSRKEHWI HFAPKSNYDS SRNIEEYFAS VASFMSLQLR
460 470 480 490 500
ELVIKSLEDL VSLFMIHKDG NDFKEPYQEM KFFIPQLIMI KLEVSEPIIV
510 520 530 540 550
FNPSFDGCWE LIRDSFLEII KNSNGIPKLK YIPLKFSFTA AAADRQCVKA
560 570 580 590 600
AEPGEPSMHA AATAMAELKG YNLLLGTVNA EEKLVSDFLI QTFKVFQKNQ
610 620 630 640 650
VGPCKYLNVY KKYVDLLDNT AEQNIAAFLK ENHDIDDFVT KINAIKKRRN
660 670 680 690 700
EIASMNITVP LAMFCLDATA LNHDLCERAQ NLKDHLIQFQ VDVNRDTNTS
710 720 730 740 750
ICNQYSHIAD KVSEVPANTK ELVSLIEFLK KSSAVTVFKL RRQLRDASER
760 770 780 790 800
LEFLMDYADL PYQIEDIFDN SRNLLLHKRD QAEMDLIKRC SEFELRLEGY
810 820 830 840 850
HRELESFRKR EVMTTEEMKH NVEKLNELSK NLNRAFAEFE LINKEEELLE
860 870 880 890 900
KEKSTYPLLQ AMLKNKVPYE QLWSTAYEFS IKSEEWMNGP LFLLNAEQIA
910 920 930 940 950
EEIGNMWRTT YKLIKTLSDV PAPRRLAENV KIKIDKFKQY IPILSISCNP
960 970 980 990 1000
GMKDRHWQQI SEIVGYEIKP TETTCLSNML EFGFGKFVEK LEPIGAAASK
1010 1020 1030 1040 1050
EYSLEKNLDR MKLDWVNVTF SFVKYRDTDT NILCAIDDIQ MLLDDHVIKT
1060 1070 1080 1090 1100
QTMCGSPFIK PIEAECRKWE EKLIRIQDNL DAWLKCQATW LYLEPIFSSE
1110 1120 1130 1140 1150
DIIAQMPEEG RKFGIVDSYW KSLMSQAVKD NRILVAADQP RMAEKLQEAN
1160 1170 1180 1190 1200
FLLEDIQKGL NDYLEKKRLF FPRFFFLSND ELLEILSETK DPLRVQPHLK
1210 1220 1230 1240 1250
KCFEGIAKLE FTDNLEIVGM ISSEKETVPF IQKIYPANAK GMVEKWLQQV
1260 1270 1280 1290 1300
EQMMLASMRE VIGLGIEAYV KVPRNHWVLQ WPGQVVICVS SIFWTQEVSQ
1310 1320 1330 1340 1350
ALAENTLLDF LKKSNDQIAQ IVQLVRGKLS SGARLTLGAL TVIDVHARDV
1360 1370 1380 1390 1400
VAKLSEDRVS DLNDFQWISQ LRYYWVAKDV QVQIITTEAL YGYEYLGNSP
1410 1420 1430 1440 1450
RLVITPLTDR CYRTLMGALK LNLGGAPEGP AGTGKTETTK DLAKALAKQC
1460 1470 1480 1490 1500
VVFNCSDGLD YKAMGKFFKG LAQAGAWACF DEFNRIEVEV LSVVAQQILS
1510 1520 1530 1540 1550
IQQAIIRKLK TFIFEGTELS LNPTCAVFIT MNPGYAGRAE LPDNLKALFR
1560 1570 1580 1590 1600
TVAMMVPDYA LIGEISLYSM GFLDSRSLAQ KIVATYRLCS EQLSSQHHYD
1610 1620 1630 1640 1650
YGMRAVKSVL TAAGNLKLKY PEENESVLLL RALLDVNLAK FLAQDVPLFQ
1660 1670 1680 1690 1700
GIISDLFPGV VLPKPDYEVF LKVLNDNIKK MKLQPVPWFI GKIIQIYEMM
1710 1720 1730 1740 1750
LVRHGYMIVG DPMGGKTSAY KVLAAALGDL HAANQMEEFA VEYKIINPKA
1760 1770 1780 1790 1800
ITMGQLYGCF DQVSHEWMDG VLANAFREQA SSLSDDRKWI IFDGPVDAIW
1810 1820 1830 1840 1850
IENMNTVLDD NKKLCLMSGE IIQMNSKMSL IFEPADLEQA SPATVSRCGM
1860 1870 1880 1890 1900
IYMEPHQLGW KPLKDSYMDT LPSSLTKEHK ELVNDMFMWL VQPCLEFGRL
1910 1920 1930 1940 1950
HCKFVVQTSP IHLAFSMMRL YSSLLDEIRA VEEEEMELGE GLSSQQIFLW
1960 1970 1980 1990 2000
LQGLFLFSLV WTVAGTINAD SRKKFDVFFR NLIMGMDDNH PRPKSVKLTK
2010 2020 2030 2040 2050
NNIFPERGSI YDFYFIKQAS GHWETWTQYI TKEEEKVPAG AKVSELIIPT
2060 2070 2080 2090 2100
METARQSFFL KTYLDHEIPM LFVGPTGTGK SAITNNFLLH LPKNTYLPNC
2110 2120 2130 2140 2150
INFSARTSAN QTQDIIMSKL DRRRKGLFGP PIGKKAVVFV DDLNMPAKEV
2160 2170 2180 2190 2200
YGAQPPIELL RQWIDHGYWF DKKDTTRLDI VDMLLVTAMG PPGGGRNDIT
2210 2220 2230 2240 2250
GRFTRHLNII SINAFEDDIL TKIFSSIVDW HFGKGFDVMF LRYGKMLVQA
2260 2270 2280 2290 2300
TKTIYRDAVE NFLPTPSKSH YVFNLRDFSR VIQGVLLCPH THLQDVEKCI
2310 2320 2330 2340 2350
RLWIHEVYRV FYDRLIDKED RQVFFNMVKE TTSNCFKQTI EKVLIHLSPT
2360 2370 2380 2390 2400
GKIVDDNIRS LFFGDYFKPE SDQKIYDEIT DLKQLTVVME HYLEEFNNIS
2410 2420 2430 2440 2450
KAPMSLVMFR FAIEHISRIC RVLKQDKGHL LLVGIGGSGR QSAAKLSTFM
2460 2470 2480 2490 2500
NAYELYQIEI TKNYAGNDWR EDLKKIILQV GVATKSTVFL FADNQIKDES
2510 2520 2530 2540 2550
FVEDINMLLN TGDVPNIFPA DEKADIVEKM QTAARTQGEK VEVTPLSMYN
2560 2570 2580 2590 2600
FFIERVINKI SFSLAMSPIG DAFRNRLRMF PSLINCCTID WFQSWPTDAL
2610 2620 2630 2640 2650
ELVANKFLED VELDDNIRVE VVSMCKYFQE SVKKLSLDYY NKLRRHNYVT
2660 2670 2680 2690 2700
PTSYLELILT FKTLLNSKRQ EVAMMRNRYL TGLQKLDFAA SQVAVMQREL
2710 2720 2730 2740 2750
TALQPQLILT SEETAKMMVK IEAETREADG KKLLVQADEK EANVAAAIAQ
2760 2770 2780 2790 2800
GIKNECEGDL AEAMPALEAA LAALDTLNPA DISLVKSMQN PPGPVKLVME
2810 2820 2830 2840 2850
SICIMKGMKP ERKPDPSGSG KMIEDYWGVS KKILGDLKFL ESLKTYDKDN
2860 2870 2880 2890 2900
IPPLTMKRIR ERFINHPEFQ PAVIKNVSSA CEGLCKWVRA MEVYDRVAKV
2910 2920 2930 2940 2950
VAPKRERLRE AEGKLAAQMQ KLNQKRAELK LVVDRLQALN DDFEEMNTKK
2960 2970 2980 2990 3000
KDLEENIEIC SQKLVRAEKL ISGLGGEKDR WTEAARQLGI RYTNLTGDVL
3010 3020 3030 3040 3050
LSSGTVAYLG AFTVDYRVQC QNQWLAECKD KVIPGFSDFS LSHTLGDPIK
3060 3070 3080 3090 3100
IRAWQIAGLP VDSFSIDNGI IVSNSRRWAL MIDPHGQANK WIKNMEKANK
3110 3120 3130 3140 3150
LAVIKFSDSN YMRMLENALQ LGTPVLIENI GEELDASIEP ILLKATFKQQ
3160 3170 3180 3190 3200
GVEYMRLGEN IIEYSRDFKL YITTRLRNPH YLPEVAVKVC LLNFMITPLG
3210 3220 3230 3240 3250
LQDQLLGIVA AKEKPELEEK KNQLIVESAK NKKHLKEIED KILEVLSMSK
3260 3270 3280 3290 3300
GNILEDETAI KVLSSSKVLS EEISEKQKVA SMTETQIDET RMGYKPVAVH
3310 3320 3330 3340 3350
SATIFFCISD LANIEPMYQY SLTWFINLYM HSLTHSTKSE ELNLRIKYII
3360 3370 3380 3390 3400
DHFTLSIYNN VCRSLFEKDK LLFSLLLTIG IMKQKKEITE EVWYFLLTGG
3410 3420 3430 3440 3450
IALDNPYPNP APQWLSEKAW AEIVRASALP KLHGLMEHLE QNLGEWKLIY
3460 3470 3480 3490 3500
DSAWPHEEQL PGSWKFSQGL EKMVILRCLR PDKMVPAVRE FIAEHMGKLY
3510 3520 3530 3540 3550
IEAPTFDLQG SYNDSSCCAP LIFVLSPSAD PMAGLLKFAD DLGMGGTRTQ
3560 3570 3580 3590 3600
TISLGQGQGP IAAKMINNAI KDGTWVVLQN CHLAASWMPT LEKICEEVIV
3610 3620 3630 3640 3650
PESTNARFRL WLTSYPSEKF PVSILQNGIK MTNEPPKGLR ANLLRSYLND
3660 3670 3680 3690 3700
PISDPVFFQS CAKAVMWQKM LFGLCFFHAV VQERRNFGPL GWNIPYEFNE
3710 3720 3730 3740 3750
SDLRISMWQI QMFLNDYKEV PFDALTYLTG ECNYGGRVTD DKDRRLLLSL
3760 3770 3780 3790 3800
LSMFYCKEIE EDYYSLAPGD TYYIPPHGSY QSYIDYLRNL PITAHPEVFG
3810 3820 3830 3840 3850
LHENADITKD NQETNQLFEG VLLTLPRQSG GSGKSPQEVV EELAQDILSK
3860 3870 3880 3890 3900
LPRDFDLEEV MKLYPVVYEE SMNTVLRQEL IRFNRLTKVV RRSLINLGRA
3910 3920 3930 3940 3950
IKGQVLMSSE LEEVFNSMLV GKVPAMWAAK SYPSLKPLGG YVADLLARLT
3960 3970 3980 3990 4000
FFQEWIDKGP PVVFWISGFY FTQSFLTGVS QNYARKYTIP IDHIGFEFEV
4010 4020 4030 4040 4050
TPQETVMENN PEDGAYIKGL FLEGARWDRK TMQIGESLPK ILYDPLPIIW
4060 4070 4080 4090 4100
LKPGESAMFL HQDIYVCPVY KTSARRGTLS TTGHSTNYVL SIELPTDMPQ
4110
KHWINRGVAS LCQLDN
Length:4,116
Mass (Da):470,771
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAF387246540D9DF2
GO
Isoform 2 (identifier: Q8TD57-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGATGRLELTLAAPPHPGPAFQRSKARETQGEEEGSEMQ → MGDMDCSSQK
     528-566: KLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMA → KVESVLFP
     762-762: Y → YEDIKLNSTLFLWPD
     790-799: CSEFELRLEG → YRESLGLSWK
     800-4116: Missing.

Show »
Length:753
Mass (Da):87,501
Checksum:i0BDED2AED898AD0C
GO
Isoform 3 (identifier: Q8TD57-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1883-1887: VNDMF → MKSGQ
     1888-4116: Missing.

Show »
Length:1,887
Mass (Da):216,078
Checksum:iDC3B4B00F469AD22
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1393Y → F in CAA10558 (Ref. 4) Curated1
Sequence conflicti1441D → V in CAB06059 (PubMed:9373155).Curated1
Sequence conflicti1601 – 1604YGMR → FGLH in CAB06059 (PubMed:9373155).Curated4
Sequence conflicti3828Q → M in CAB46377 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_039412484I → L in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_039413545R → W. Corresponds to variant dbSNP:rs16970910Ensembl.1
Natural variantiVAR_0394141565I → M. Corresponds to variant dbSNP:rs330150EnsemblClinVar.1
Natural variantiVAR_0394151583V → I. Corresponds to variant dbSNP:rs16970832Ensembl.1
Natural variantiVAR_0394161608S → F in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0394171752T → M. Corresponds to variant dbSNP:rs13332291Ensembl.1
Natural variantiVAR_0394182399I → N. Corresponds to variant dbSNP:rs34179606EnsemblClinVar.1
Natural variantiVAR_0394192804I → V. Corresponds to variant dbSNP:rs12929546Ensembl.1
Natural variantiVAR_0394202949K → T. Corresponds to variant dbSNP:rs33928718Ensembl.1
Natural variantiVAR_0394213457E → K. Corresponds to variant dbSNP:rs3743695Ensembl.1
Natural variantiVAR_0394223639L → I. Corresponds to variant dbSNP:rs34771199Ensembl.1
Natural variantiVAR_0394233645R → C. Corresponds to variant dbSNP:rs12924551Ensembl.1
Natural variantiVAR_0394243744R → W. Corresponds to variant dbSNP:rs2301620Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0319191 – 39MGATG…GSEMQ → MGDMDCSSQK in isoform 2. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_031920528 – 566KLKYI…ATAMA → KVESVLFP in isoform 2. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_031921762Y → YEDIKLNSTLFLWPD in isoform 2. 1 Publication1
Alternative sequenceiVSP_031922790 – 799CSEFELRLEG → YRESLGLSWK in isoform 2. 1 Publication10
Alternative sequenceiVSP_031923800 – 4116Missing in isoform 2. 1 PublicationAdd BLAST3317
Alternative sequenceiVSP_0319241883 – 1887VNDMF → MKSGQ in isoform 3. 1 Publication5
Alternative sequenceiVSP_0319251888 – 4116Missing in isoform 3. 1 PublicationAdd BLAST2229

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF494040 mRNA Translation: AAM12861.1
AK056509 mRNA Translation: BAE46616.1
CH471228 Genomic DNA Translation: EAW66851.1
AJ132085 mRNA Translation: CAA10558.1
AJ132092 Genomic DNA Translation: CAA10565.1
Z83805 mRNA Translation: CAB06059.1
U83574 Genomic DNA Translation: AAB82763.1
BC019878 mRNA Translation: AAH19878.1
AL096732 mRNA Translation: CAB46377.1
AC002394 Genomic DNA Translation: AAC05809.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10594.1 [Q8TD57-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T12545

NCBI Reference Sequences

More...
RefSeqi
NP_001334815.1, NM_001347886.1
NP_060009.1, NM_017539.2 [Q8TD57-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261383; ENSP00000261383; ENSG00000158486

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55567

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55567

UCSC genome browser

More...
UCSCi
uc010vbe.3, human [Q8TD57-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF494040 mRNA Translation: AAM12861.1
AK056509 mRNA Translation: BAE46616.1
CH471228 Genomic DNA Translation: EAW66851.1
AJ132085 mRNA Translation: CAA10558.1
AJ132092 Genomic DNA Translation: CAA10565.1
Z83805 mRNA Translation: CAB06059.1
U83574 Genomic DNA Translation: AAB82763.1
BC019878 mRNA Translation: AAH19878.1
AL096732 mRNA Translation: CAB46377.1
AC002394 Genomic DNA Translation: AAC05809.1
CCDSiCCDS10594.1 [Q8TD57-1]
PIRiT12545
RefSeqiNP_001334815.1, NM_001347886.1
NP_060009.1, NM_017539.2 [Q8TD57-1]

3D structure databases

SMRiQ8TD57
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi120722, 7 interactors
IntActiQ8TD57, 6 interactors
STRINGi9606.ENSP00000261383

PTM databases

CarbonylDBiQ8TD57
GlyGeniQ8TD57, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ8TD57
PhosphoSitePlusiQ8TD57

Genetic variation databases

BioMutaiDNAH3
DMDMi74762616

Proteomic databases

EPDiQ8TD57
jPOSTiQ8TD57
MassIVEiQ8TD57
MaxQBiQ8TD57
PaxDbiQ8TD57
PeptideAtlasiQ8TD57
PRIDEiQ8TD57
ProteomicsDBi74244 [Q8TD57-1]
74245 [Q8TD57-2]
74246 [Q8TD57-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
67049, 29 antibodies from 6 providers

The DNASU plasmid repository

More...
DNASUi
55567

Genome annotation databases

EnsembliENST00000261383; ENSP00000261383; ENSG00000158486
GeneIDi55567
KEGGihsa:55567
UCSCiuc010vbe.3, human [Q8TD57-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55567
DisGeNETi55567

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DNAH3
HGNCiHGNC:2949, DNAH3
HPAiENSG00000158486, Tissue enhanced (brain, fallopian tube, testis)
MIMi603334, gene
neXtProtiNX_Q8TD57
OpenTargetsiENSG00000158486
PharmGKBiPA27402
VEuPathDBiHostDB:ENSG00000158486

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3595, Eukaryota
GeneTreeiENSGT00940000154959
HOGENOMiCLU_000038_0_1_1
InParanoidiQ8TD57
OMAiFFQSCAK
OrthoDBi2079at2759
PhylomeDBiQ8TD57
TreeFamiTF316836

Enzyme and pathway databases

PathwayCommonsiQ8TD57
SignaLinkiQ8TD57

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
55567, 3 hits in 1033 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DNAH3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55567
PharosiQ8TD57, Tdark

Protein Ontology

More...
PROi
PR:Q8TD57
RNActiQ8TD57, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000158486, Expressed in epithelium of bronchus and 135 other tissues
GenevisibleiQ8TD57, HS

Family and domain databases

Gene3Di1.10.8.710, 1 hit
1.10.8.720, 1 hit
1.20.140.100, 1 hit
3.10.490.20, 1 hit
3.20.180.20, 1 hit
3.40.50.300, 5 hits
InterProiView protein in InterPro
IPR003593, AAA+_ATPase
IPR035699, AAA_6
IPR035706, AAA_9
IPR041658, AAA_lid_11
IPR042219, AAA_lid_11_sf
IPR026983, DHC_fam
IPR041589, DNAH3_AAA_lid_1
IPR042222, Dynein_2_N
IPR043157, Dynein_AAA1S
IPR041466, Dynein_AAA5_ext
IPR041228, Dynein_C
IPR043160, Dynein_C_barrel
IPR024743, Dynein_HC_stalk
IPR024317, Dynein_heavy_chain_D4_dom
IPR004273, Dynein_heavy_D6_P-loop
IPR013602, Dynein_heavy_linker
IPR042228, Dynein_linker_3
IPR027417, P-loop_NTPase
PANTHERiPTHR10676, PTHR10676, 1 hit
PfamiView protein in Pfam
PF12774, AAA_6, 1 hit
PF12780, AAA_8, 1 hit
PF12781, AAA_9, 1 hit
PF17857, AAA_lid_1, 1 hit
PF18198, AAA_lid_11, 1 hit
PF08393, DHC_N2, 1 hit
PF17852, Dynein_AAA_lid, 1 hit
PF18199, Dynein_C, 1 hit
PF03028, Dynein_heavy, 1 hit
PF12777, MT, 1 hit
SMARTiView protein in SMART
SM00382, AAA, 2 hits
SUPFAMiSSF52540, SSF52540, 4 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDYH3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TD57
Secondary accession number(s): O00437
, O15437, O43326, Q3C0H2, Q8WUP9, Q9UEM3, Q9UEM5, Q9UG35
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: June 1, 2002
Last modified: February 23, 2022
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again