Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (16 Oct 2019)
Sequence version 4 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Chromodomain-helicase-DNA-binding protein 6

Gene

CHD6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA-dependent ATPase that plays a role in chromatin remodeling. Regulates transcription by disrupting nucleosomes in a largely non-sliding manner which strongly increases the accessibility of chromatin (PubMed:28533432). Activates transcription of specific genes in response to oxidative stress through interaction with NFE2L2.2 Publications
(Microbial infection) Acts as a transcriptional repressor of different viruses including influenza virus or papillomavirus. During influenza virus infection, the viral polymerase complex localizes CHD6 to inactive chromatin where it gets degraded in a proteasome independent-manner.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi486 – 493ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, DNA-binding, Helicase, Hydrolase
Biological processHost-virus interaction, Transcription, Transcription regulation
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Chromodomain-helicase-DNA-binding protein 6 (EC:3.6.4.12)
Short name:
CHD-6
Alternative name(s):
ATP-dependent helicase CHD6
Radiation-induced gene B protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CHD6
Synonyms:CHD5, KIAA1335, RIGB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19057 CHD6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616114 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TD26

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration disrupting CHD6 has been found in a patient with mild to moderate mental retardation and minor facial anomalies. Translocation t(18;20)(q21.1;q11.2) with TCF4 producing a CHD6-TCF4 fusion transcript (PubMed:18627065).1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
84181

Open Targets

More...
OpenTargetsi
ENSG00000124177

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134974700

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TD26

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CHD6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439466

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000802311 – 2715Chromodomain-helicase-DNA-binding protein 6Add BLAST2715

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TD26

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TD26

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TD26

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TD26

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TD26

PeptideAtlas

More...
PeptideAtlasi
Q8TD26

PRoteomics IDEntifications database

More...
PRIDEi
Q8TD26

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74223 [Q8TD26-1]
74224 [Q8TD26-2]
74225 [Q8TD26-3]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q8TD26

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TD26

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TD26

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000124177 Expressed in 197 organ(s), highest expression level in lung

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TD26 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TD26 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA015543

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NFE2L2; involved in activation of the transcription.

1 Publication

(Microbial infection) Interacts with the influenza A polymerase complex composed fo PB1, PB2 and PA.

1 Publication

(Microbial infection) Interacts (via N-terminus) with human papillomavirus protein E8^E2C (via C-terminus); this interaction induces transcriptional repression of the viral genome.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123931, 21 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TD26, 15 interactors

Molecular INTeraction database

More...
MINTi
Q8TD26

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362330

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12715
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TD26

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8TD26

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini292 – 343Chromo 1PROSITE-ProRule annotationAdd BLAST52
Domaini375 – 439Chromo 2PROSITE-ProRule annotationAdd BLAST65
Domaini473 – 647Helicase ATP-bindingPROSITE-ProRule annotationAdd BLAST175
Domaini787 – 956Helicase C-terminalPROSITE-ProRule annotationAdd BLAST170
Domaini1449 – 1503Myb-likeAdd BLAST55

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 747Required for DNA-dependent ATPase activityAdd BLAST747

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi598 – 601DEAH box4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi93 – 202Lys-richAdd BLAST110

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SNF2/RAD54 helicase family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0383 Eukaryota
COG0553 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158986

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TD26

KEGG Orthology (KO)

More...
KOi
K14436

Identification of Orthologs from Complete Genome Data

More...
OMAi
AKDERKH

Database of Orthologous Groups

More...
OrthoDBi
7181at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TD26

TreeFam database of animal gene trees

More...
TreeFami
TF313572

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.10810, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006576 BRK_domain
IPR037259 BRK_sf
IPR016197 Chromo-like_dom_sf
IPR000953 Chromo/chromo_shadow_dom
IPR023780 Chromo_domain
IPR002464 DNA/RNA_helicase_DEAH_CS
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR027417 P-loop_NTPase
IPR038718 SNF2-like_sf
IPR000330 SNF2_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00385 Chromo, 2 hits
PF00271 Helicase_C, 1 hit
PF00176 SNF2_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00592 BRK, 1 hit
SM00298 CHROMO, 2 hits
SM00487 DEXDc, 1 hit
SM00490 HELICc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF160481 SSF160481, 1 hit
SSF52540 SSF52540, 2 hits
SSF54160 SSF54160, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50013 CHROMO_2, 1 hit
PS00690 DEAH_ATP_HELICASE, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TD26-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKMKIQKKEK QLSNLKVLNH SPMSDASVNF DYKSPSPFDC STDQEEKIED
60 70 80 90 100
VASHCLPQKD LYTAEEEAAT LFPRKMTSHN GMEDSGGGGT GVKKKRKKKE
110 120 130 140 150
PGDQEGAAKG SKDREPKPKR KREPKEPKEP RKAKEPKKAK EHKEPKQKDG
160 170 180 190 200
AKKARKPREA SGTKEAKEKR SCTDSAARTK SRKASKEQGP TPVEKKKKGK
210 220 230 240 250
RKSETTVESL ELDQGLTNPS LRSPEESTES TDSQKRRSGR QVKRRKYNED
260 270 280 290 300
LDFKVVDDDG ETIAVLGAGR TSALSASTLA WQAEEPPEDD ANIIEKILAS
310 320 330 340 350
KTVQEVHPGE PPFDLELFYV KYRNFSYLHC KWATMEELEK DPRIAQKIKR
360 370 380 390 400
FRNKQAQMKH IFTEPDEDLF NPDYVEVDRI LEVAHTKDAE TGEEVTHYLV
410 420 430 440 450
KWCSLPYEES TWELEEDVDP AKVKEFESLQ VLPEIKHVER PASDSWQKLE
460 470 480 490 500
KSREYKNSNQ LREYQLEGMN WLLFNWYNRK NCILADEMGL GKTIQSITFL
510 520 530 540 550
SEIFLRGIHG PFLIIAPLST ITNWEREFRT WTEMNAIVYH GSQISRQMIQ
560 570 580 590 600
QYEMVYRDAQ GNPLSGVFKF HVVITTFEMI LADCPELKKI HWSCVIIDEA
610 620 630 640 650
HRLKNRNCKL LEGLKLMALE HKVLLTGTPL QNSVEELFSL LNFLEPSQFP
660 670 680 690 700
SETAFLEEFG DLKTEEQVKK LQSILKPMML RRLKDDVEKN LAPKQETIIE
710 720 730 740 750
VELTNIQKKY YRAILEKNFS FLTKGANQHN MPNLINTMME LRKCCNHPYL
760 770 780 790 800
INGAEEKILE DFRKTHSPDA PDFQLQAMIQ AAGKLVLIDK LLPKLIAGGH
810 820 830 840 850
KVLIFSQMVR CLDILEDYLI QRRYTYERID GRVRGNLRQA AIDRFCKPDS
860 870 880 890 900
DRFVFLLCTR AGGLGINLTA ADTCIIFDSD WNPQNDLQAQ ARCHRIGQSK
910 920 930 940 950
AVKVYRLITR NSYEREMFDK ASLKLGLDKA VLQDINRKGG TNGVQQLSKM
960 970 980 990 1000
EVEDLLRKGA YGALMDEEDE GSKFCEEDID QILQRRTHTI TIQSEGKGST
1010 1020 1030 1040 1050
FAKASFVASG NRTDISLDDP NFWQKWAKIA ELDTEAKNEK ESLVIDRPRV
1060 1070 1080 1090 1100
RKQTKHYNSF EEDELMEFSE LDSDSDERPT RSRRLNDKAR RYLRAECFRV
1110 1120 1130 1140 1150
EKNLLIFGWG RWKDILTHGR FKWHLNEKDM EMICRALLVY CVKHYKGDEK
1160 1170 1180 1190 1200
IKSFIWELIT PTKDGQAQTL QNHSGLSAPV PRGRKGKKTK NQLLIPELKD
1210 1220 1230 1240 1250
ADWLATCNPE VVLHDDGYKK HLKQHCNKVL LRVRMLYYLK AEILGEAAEK
1260 1270 1280 1290 1300
AFEGSPAREL DVPLPDIDYM EIPVDWWDAE ADKSLLIGVF KHGYERYNAM
1310 1320 1330 1340 1350
RADPALCFLE KVGMPDEKSL SAEQGVTDGT SDIPERGNTD KEDNAEDKVD
1360 1370 1380 1390 1400
GLQKQTESSS DGGDGVFSEK KDDSRAAQDG SDPDKSPWPV SSALTARLRR
1410 1420 1430 1440 1450
LVTVYQRCNR KELCRPEILG PGNQGYWVQE EMFRRTSEMD LINKEAQKRW
1460 1470 1480 1490 1500
TRREQADFYR TVSSFGVVYD QEKKTFDWTQ FRIISRLDKK SDESLEQYFY
1510 1520 1530 1540 1550
SFVAMCRNVC RLPTWKDGGP PDTTIYVEPI TEERAARTLY RIELLRKVRE
1560 1570 1580 1590 1600
QVLKCPQLHE RLQLCRPSLY LPVWWECGKH DRDLLIGTAK HGLNRTDCYI
1610 1620 1630 1640 1650
MNDPQLSFLD AYRNYAQHKR SGTQAPGNLC CLYQTNSKLY ESLTYSQMSR
1660 1670 1680 1690 1700
TSESLENEPE NLVRVESRDD HLSLPDVTCE NFISKVQDVI SINHDESLLP
1710 1720 1730 1740 1750
ESLESMMYGK KVLSQEPSSF QESPSTNTES RKDVITISIS KDGNCQSGGP
1760 1770 1780 1790 1800
EAEIASGPTF MGSLEAGGVA QANIKNGKHL LMSISKEGEL CCSEAGQRPE
1810 1820 1830 1840 1850
NIGQLEAKCL ASPSLNPGNE SGFVDMCSLS VCDSKRNLSS DQQLIDLLEN
1860 1870 1880 1890 1900
KSLESKLILS QNHSDEEEEE EENEEENLAM AVGMGERPEV LHLTEPTTNI
1910 1920 1930 1940 1950
SREKNQGFQD ETKKGSLEVA NQTPGLQRAF PAPAACQCHC KHMERWMHGL
1960 1970 1980 1990 2000
ENDEFEIEKP KAYIPDLFKS KTNTIAMEGE PTAIPSQPFK VKHELLKEPW
2010 2020 2030 2040 2050
KESAEGQNVF PTYPLEGSEL KSEDMDFENK DDYDRDGNCH SQDYPGKYSE
2060 2070 2080 2090 2100
EESKSSTSGI TGDIGDELQE ARAPTIAQLL QEKTLYSFSE WPKDRVIINR
2110 2120 2130 2140 2150
LDNICHVVLK GKWPSSQQYE PSGTLPTPVL TSSAGSRTSL SEPEAAEHSF
2160 2170 2180 2190 2200
SNGAALAAQI HKESFLAPVF TKDEQKHRRP YEFEVERDAK ARGLEQFSAT
2210 2220 2230 2240 2250
HGHTPIILNG WHGESAMDLS CSSEGSPGAT SPFPVSASTP KIGAISSLQG
2260 2270 2280 2290 2300
ALGMDLSGIL QAGLIHPVTG QIVNGSLRRD DAATRRRRGR RKHVEGGMDL
2310 2320 2330 2340 2350
IFLKEQTLQA GILEVHEDPG QATLSTTHPE GPGPATSAPE PATAASSQAE
2360 2370 2380 2390 2400
KSIPSKSLLD WLRQQADYSL EVPGFGANFS DKPKQRRPRC KEPGKLDVSS
2410 2420 2430 2440 2450
LSGEERVPAI PKEPGLRGFL PENKFNHTLA EPILRDTGPR RRGRRPRSEL
2460 2470 2480 2490 2500
LKAPSIVADS PSGMGPLFMN GLIAGMDLVG LQNMRNMPGI PLTGLVGFPA
2510 2520 2530 2540 2550
GFATMPTGEE VKSTLSMLPM MLPGMAAVPQ MFGVGGLLSP PMATTCTSTA
2560 2570 2580 2590 2600
PASLSSTTKS GTAVTEKTAE DKPSSHDVKT DTLAEDKPGP GPFSDQSEPA
2610 2620 2630 2640 2650
ITTSSPVAFN PFLIPGVSPG LIYPSMFLSP GMGMALPAMQ QARHSEIVGL
2660 2670 2680 2690 2700
ESQKRKKKKT KGDNPNSHPE PAPSCEREPS GDENCAEPSA PLPAEREHGA
2710
QAGEGALKDS NNDTN
Length:2,715
Mass (Da):305,412
Last modified:May 18, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5B3FEC537340A8B7
GO
Isoform 2 (identifier: Q8TD26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MKMKIQKKEK → MCQSHMIGFCTSSVNEETETQGDQISCPNPTTLVFRTQISSLPSL
     325-338: FSYLHCKWATMEEL → LYVYLKYSLYLGFI
     339-2715: Missing.

Note: Gene prediction based on EST data.
Show »
Length:373
Mass (Da):41,654
Checksum:i0264B708481CB446
GO
Isoform 3 (identifier: Q8TD26-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     592-1108: Missing.
     1337-1339: GNT → QHR
     1340-2715: Missing.

Note: No experimental confirmation available.
Show »
Length:822
Mass (Da):94,609
Checksum:iBC0D0A3987286332
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A075B6P4A0A075B6P4_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD6
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JFU2C9JFU2_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD6
488Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C294H7C294_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD6
525Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAK56405 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAN59903 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB15325 differs from that shown. The sequence differs from position 1528 onward for unknown reasons.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti134K → E in AAK56405 (PubMed:11889561).Curated1
Sequence conflicti575T → A in AAN59903 (Ref. 4) Curated1
Sequence conflicti1031E → K in AAK56405 (PubMed:11889561).Curated1
Sequence conflicti2442 – 2447RGRRPR → EIVGLE in AAH21907 (PubMed:15489334).Curated6
Sequence conflicti2663D → G in AAK56405 (PubMed:11889561).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059213780Q → H. Corresponds to variant dbSNP:rs4474937Ensembl.1
Natural variantiVAR_0233632161H → Q. Corresponds to variant dbSNP:rs3817893Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0152961 – 10MKMKIQKKEK → MCQSHMIGFCTSSVNEETET QGDQISCPNPTTLVFRTQIS SLPSL in isoform 2. 1 Publication10
Alternative sequenceiVSP_015297325 – 338FSYLH…TMEEL → LYVYLKYSLYLGFI in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_015298339 – 2715Missing in isoform 2. 1 PublicationAdd BLAST2377
Alternative sequenceiVSP_015299592 – 1108Missing in isoform 3. 1 PublicationAdd BLAST517
Alternative sequenceiVSP_0153001337 – 1339GNT → QHR in isoform 3. 1 Publication3
Alternative sequenceiVSP_0153011340 – 2715Missing in isoform 3. 1 PublicationAdd BLAST1376

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY034072 mRNA Translation: AAK56405.1 Different initiation.
AL031667 Genomic DNA No translation available.
AL031669 Genomic DNA No translation available.
AL121674 Genomic DNA No translation available.
BC021907 mRNA Translation: AAH21907.1
BC039860 mRNA No translation available.
BC040016 mRNA No translation available.
AF525085 mRNA Translation: AAN59903.1 Different initiation.
AB037756 mRNA Translation: BAA92573.2
AK026022 mRNA Translation: BAB15325.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13317.1 [Q8TD26-1]

NCBI Reference Sequences

More...
RefSeqi
NP_115597.3, NM_032221.4 [Q8TD26-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000373222; ENSP00000362319; ENSG00000124177 [Q8TD26-2]
ENST00000373233; ENSP00000362330; ENSG00000124177 [Q8TD26-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84181

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84181

UCSC genome browser

More...
UCSCi
uc002xka.3 human [Q8TD26-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY034072 mRNA Translation: AAK56405.1 Different initiation.
AL031667 Genomic DNA No translation available.
AL031669 Genomic DNA No translation available.
AL121674 Genomic DNA No translation available.
BC021907 mRNA Translation: AAH21907.1
BC039860 mRNA No translation available.
BC040016 mRNA No translation available.
AF525085 mRNA Translation: AAN59903.1 Different initiation.
AB037756 mRNA Translation: BAA92573.2
AK026022 mRNA Translation: BAB15325.1 Sequence problems.
CCDSiCCDS13317.1 [Q8TD26-1]
RefSeqiNP_115597.3, NM_032221.4 [Q8TD26-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EPBNMR-A371-431[»]
SMRiQ8TD26
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi123931, 21 interactors
IntActiQ8TD26, 15 interactors
MINTiQ8TD26
STRINGi9606.ENSP00000362330

PTM databases

CarbonylDBiQ8TD26
iPTMnetiQ8TD26
PhosphoSitePlusiQ8TD26

Polymorphism and mutation databases

BioMutaiCHD6
DMDMi296439466

Proteomic databases

EPDiQ8TD26
jPOSTiQ8TD26
MassIVEiQ8TD26
MaxQBiQ8TD26
PaxDbiQ8TD26
PeptideAtlasiQ8TD26
PRIDEiQ8TD26
ProteomicsDBi74223 [Q8TD26-1]
74224 [Q8TD26-2]
74225 [Q8TD26-3]

Genome annotation databases

EnsembliENST00000373222; ENSP00000362319; ENSG00000124177 [Q8TD26-2]
ENST00000373233; ENSP00000362330; ENSG00000124177 [Q8TD26-1]
GeneIDi84181
KEGGihsa:84181
UCSCiuc002xka.3 human [Q8TD26-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84181
DisGeNETi84181

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CHD6
HGNCiHGNC:19057 CHD6
HPAiHPA015543
MIMi616114 gene
neXtProtiNX_Q8TD26
OpenTargetsiENSG00000124177
PharmGKBiPA134974700

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0383 Eukaryota
COG0553 LUCA
GeneTreeiENSGT00940000158986
InParanoidiQ8TD26
KOiK14436
OMAiAKDERKH
OrthoDBi7181at2759
PhylomeDBiQ8TD26
TreeFamiTF313572

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CHD6 human
EvolutionaryTraceiQ8TD26

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84181
PharosiQ8TD26

Protein Ontology

More...
PROi
PR:Q8TD26

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000124177 Expressed in 197 organ(s), highest expression level in lung
ExpressionAtlasiQ8TD26 baseline and differential
GenevisibleiQ8TD26 HS

Family and domain databases

Gene3Di3.40.50.10810, 1 hit
InterProiView protein in InterPro
IPR006576 BRK_domain
IPR037259 BRK_sf
IPR016197 Chromo-like_dom_sf
IPR000953 Chromo/chromo_shadow_dom
IPR023780 Chromo_domain
IPR002464 DNA/RNA_helicase_DEAH_CS
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR027417 P-loop_NTPase
IPR038718 SNF2-like_sf
IPR000330 SNF2_N
PfamiView protein in Pfam
PF00385 Chromo, 2 hits
PF00271 Helicase_C, 1 hit
PF00176 SNF2_N, 1 hit
SMARTiView protein in SMART
SM00592 BRK, 1 hit
SM00298 CHROMO, 2 hits
SM00487 DEXDc, 1 hit
SM00490 HELICc, 1 hit
SUPFAMiSSF160481 SSF160481, 1 hit
SSF52540 SSF52540, 2 hits
SSF54160 SSF54160, 2 hits
PROSITEiView protein in PROSITE
PS50013 CHROMO_2, 1 hit
PS00690 DEAH_ATP_HELICASE, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCHD6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TD26
Secondary accession number(s): Q5JYQ0
, Q5TGZ9, Q5TH00, Q5TH01, Q8IZR2, Q8WTY0, Q9H4H6, Q9H6D4, Q9NTT7, Q9P2L1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: May 18, 2010
Last modified: October 16, 2019
This is version 175 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again