Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8TD07 (RAE1E_HUMAN)

Entry version 152 (11 Dec 2019)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Retinoic acid early transcript 1E

Gene

RAET1E

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.2 Publications

Miscellaneous

UL16-binding proteins (ULBPs) are unusual members of the extended MHC class I superfamily. They do not contain the alpha 3 domain and lack a transmembrane domain.Curated

Caution

Contrary to other family members, does not interact with CMV glycoprotein UL16.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processImmunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Retinoic acid early transcript 1E1 PublicationImported
Alternative name(s):
Lymphocyte effector toxicity activation ligand1 Publication
NKG2D ligand 4
Short name:
N2DL-4
Short name:
NKG2DL4
RAE-1-like transcript 41 Publication
UL16-binding protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RAET1E1 PublicationImported
Synonyms:LETAL1 Publication, N2DL4, ULBP41 Publication
ORF Names:UNQ1867/PRO43031 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000164520.11

Human Gene Nomenclature Database

More...HGNCi		HGNC:16793 RAET1E

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609243 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8TD07

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini31 – 225ExtracellularSequence analysisAdd BLAST195
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei226 – 248HelicalSequence analysisAdd BLAST23
Topological domaini249 – 263CytoplasmicSequence analysisAdd BLAST15

Keywords - Cellular componenti

Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		135250

Open Targets

More...OpenTargetsi		ENSG00000164520

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134913788

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8TD07 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RAET1E

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30Sequence analysisAdd BLAST30
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001902131 – 263Retinoic acid early transcript 1EAdd BLAST233

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi36N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi126 ↔ 189By similarity
Glycosylationi154N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi212N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8TD07

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8TD07

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8TD07

PeptideAtlas

More...PeptideAtlasi		Q8TD07

PRoteomics IDEntifications database

More...PRIDEi		Q8TD07

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		1774
74206 [Q8TD07-1]
74207 [Q8TD07-2]
74208 [Q8TD07-3]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8TD07

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in the skin, but also expressed in testis and trachea. Up-regulated in tumor cells of different origins. Expression progressively decreased after treatment of tumor cells with retinoic acid.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000164520 Expressed in 90 organ(s), highest expression level in ectocervix

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8TD07 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8TD07 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA054022

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds to KLRK1/NKG2D.

2 Publications

(Microbial infection) Contrary to other family members, does not interact with CMV glycoprotein UL16.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P267184EBI-16365677,EBI-458344

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		126425, 19 interactors

Protein interaction database and analysis system

More...IntActi		Q8TD07, 19 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000349709

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8TD07 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni31 – 116MHC class I alpha-1 like; down-regulates the cell surface expression of KLRK11 PublicationAdd BLAST86
Regioni117 – 207MHC class I alpha-2 like; down-regulates the cell surface expression of KLRK11 PublicationAdd BLAST91

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi219 – 222Poly-Ser4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

MHC class I alpha-1 like and MHC class I alpha- like regions down-regulate the cell surface expression of KLRK1.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MHC class I family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410JBPA Eukaryota
ENOG411150N LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00980000198495

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000070028

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8TD07

KEGG Orthology (KO)

More...KOi		K07987

Identification of Orthologs from Complete Genome Data

More...OMAi		SLPDTWI

Database of Orthologous Groups

More...OrthoDBi		1092787at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8TD07

TreeFam database of animal gene trees

More...TreeFami		TF339658

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.500.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011161 MHC_I-like_Ag-recog
IPR037055 MHC_I-like_Ag-recog_sf
IPR011162 MHC_I/II-like_Ag-recog

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00129 MHC_I, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54452 SSF54452, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TD07-1) [UniParc]FASTAAdd to basket
Also known as: ULBP41 Publication, RAET1E1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRISLTSSP VRLLLFLLLL LIALEIMVGG HSLCFNFTIK SLSRPGQPWC 
        60         70         80         90        100
EAQVFLNKNL FLQYNSDNNM VKPLGLLGKK VYATSTWGEL TQTLGEVGRD 
       110        120        130        140        150
LRMLLCDIKP QIKTSDPSTL QVEMFCQREA ERCTGASWQF ATNGEKSLLF 
       160        170        180        190        200
DAMNMTWTVI NHEASKIKET WKKDRGLEKY FRKLSKGDCD HWLREFLGHW 
       210        220        230        240        250
EAMPEPTVSP VNASDIHWSS SSLPDRWIIL GAFILLVLMG IVLICVWWQN 
       260 
GEWQAGLWPL RTS
Length:263
Mass (Da):30,122
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3309279B51B603C8
GO
Isoform 2 (identifier: Q8TD07-2) [UniParc]FASTAAdd to basket
Also known as: RL-41 Publication, ULBP4-II1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     28-63: Missing.

Show »
Length:227
Mass (Da):26,059
Checksum:iF1644DD3F54FBD81
GO
Isoform 3 (identifier: Q8TD07-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-212: VSPVN → GRRST
     213-263: Missing.

Show »
Length:212
Mass (Da):24,364
Checksum:i371CA577033747DC
GO
Isoform 4 (identifier: Q8TD07-4) [UniParc]FASTAAdd to basket
Also known as: RAET1E21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     208-263: VSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS → GN

Show »
Length:209
Mass (Da):23,978
Checksum:iA7433747DC7581C6
GO
Isoform 5 (identifier: Q8TD07-5) [UniParc]FASTAAdd to basket
Also known as: ULBP4-III1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     165-208: SKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTV → M

Show »
Length:220
Mass (Da):24,894
Checksum:i9CBCE1A47F79FA3A
GO
Isoform 6 (identifier: Q8TD07-6) [UniParc]FASTAAdd to basket
Also known as: ULBP4-I1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     29-29: G → GECPEHKNWLRTRRREKG

Show »
Length:280
Mass (Da):32,300
Checksum:i777BF99FA2064F9B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3T1D4Q3T1D4_HUMAN
RAET1E protein
RAET1E
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKJ6E9PKJ6_HUMAN
Retinoic acid early transcript 1E
RAET1E
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti141 – 142AT → TI in AAL76417 (PubMed:11827464).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02453412R → H. Corresponds to variant dbSNP:rs9383583Ensembl.1
Natural variantiVAR_02027182Y → N2 PublicationsCorresponds to variant dbSNP:rs2151910Ensembl.1
Natural variantiVAR_024535128R → H1 PublicationCorresponds to variant dbSNP:rs6925151Ensembl.1
Natural variantiVAR_050408141A → T. Corresponds to variant dbSNP:rs9383921Ensembl.1
Natural variantiVAR_050409142T → I. Corresponds to variant dbSNP:rs9371533Ensembl.1
Natural variantiVAR_061483194R → G. Corresponds to variant dbSNP:rs57292884Ensembl.1
Natural variantiVAR_024536237V → L. Corresponds to variant dbSNP:rs2342767Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01044128 – 63Missing in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_05926229G → GECPEHKNWLRTRRREKG in isoform 6. 1 Publication1
Alternative sequenceiVSP_059263165 – 208SKIKE…PEPTV → M in isoform 5. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_045012208 – 263VSPVN…PLRTS → GN in isoform 4. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_010442208 – 212VSPVN → GRRST in isoform 3. 1 Publication5
Alternative sequenceiVSP_010443213 – 263Missing in isoform 3. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY069961 mRNA Translation: AAL58090.1
AY252119 mRNA Translation: AAP15166.1
AY176317 mRNA Translation: AAO22240.1
EF489426 mRNA Translation: ABR29881.1
AY054974 mRNA Translation: AAL11005.1
AY359075 mRNA Translation: AAQ89434.1
AL355312 Genomic DNA No translation available.
AF359243 mRNA Translation: AAL76417.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5221.1 [Q8TD07-1]
CCDS59042.1 [Q8TD07-4]
CCDS59043.1 [Q8TD07-3]
CCDS59044.1 [Q8TD07-2]

NCBI Reference Sequences

More...RefSeqi		NP_001230254.1, NM_001243325.1 [Q8TD07-2]
NP_001230256.1, NM_001243327.1 [Q8TD07-4]
NP_001230257.1, NM_001243328.1 [Q8TD07-3]
NP_631904.1, NM_139165.2 [Q8TD07-1]
XP_011533781.1, XM_011535479.2 [Q8TD07-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000357183; ENSP00000349709; ENSG00000164520 [Q8TD07-1]
ENST00000367363; ENSP00000356332; ENSG00000164520 [Q8TD07-2]
ENST00000529948; ENSP00000432366; ENSG00000164520 [Q8TD07-4]
ENST00000532335; ENSP00000437067; ENSG00000164520 [Q8TD07-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		135250

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:135250

UCSC genome browser

More...UCSCi		uc003qnj.3 human [Q8TD07-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY069961 mRNA Translation: AAL58090.1
AY252119 mRNA Translation: AAP15166.1
AY176317 mRNA Translation: AAO22240.1
EF489426 mRNA Translation: ABR29881.1
AY054974 mRNA Translation: AAL11005.1
AY359075 mRNA Translation: AAQ89434.1
AL355312 Genomic DNA No translation available.
AF359243 mRNA Translation: AAL76417.1
CCDSiCCDS5221.1 [Q8TD07-1]
CCDS59042.1 [Q8TD07-4]
CCDS59043.1 [Q8TD07-3]
CCDS59044.1 [Q8TD07-2]
RefSeqiNP_001230254.1, NM_001243325.1 [Q8TD07-2]
NP_001230256.1, NM_001243327.1 [Q8TD07-4]
NP_001230257.1, NM_001243328.1 [Q8TD07-3]
NP_631904.1, NM_139165.2 [Q8TD07-1]
XP_011533781.1, XM_011535479.2 [Q8TD07-3]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi126425, 19 interactors
IntActiQ8TD07, 19 interactors
STRINGi9606.ENSP00000349709

PTM databases

PhosphoSitePlusiQ8TD07

Polymorphism and mutation databases

BioMutaiRAET1E

Proteomic databases

jPOSTiQ8TD07
MassIVEiQ8TD07
PaxDbiQ8TD07
PeptideAtlasiQ8TD07
PRIDEiQ8TD07
ProteomicsDBi1774
74206 [Q8TD07-1]
74207 [Q8TD07-2]
74208 [Q8TD07-3]

Genome annotation databases

EnsembliENST00000357183; ENSP00000349709; ENSG00000164520 [Q8TD07-1]
ENST00000367363; ENSP00000356332; ENSG00000164520 [Q8TD07-2]
ENST00000529948; ENSP00000432366; ENSG00000164520 [Q8TD07-4]
ENST00000532335; ENSP00000437067; ENSG00000164520 [Q8TD07-3]
GeneIDi135250
KEGGihsa:135250
UCSCiuc003qnj.3 human [Q8TD07-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		135250
DisGeNETi135250
EuPathDBiHostDB:ENSG00000164520.11

GeneCards: human genes, protein and diseases

More...GeneCardsi		RAET1E
HGNCiHGNC:16793 RAET1E
HPAiHPA054022
MIMi609243 gene
neXtProtiNX_Q8TD07
OpenTargetsiENSG00000164520
PharmGKBiPA134913788

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410JBPA Eukaryota
ENOG411150N LUCA
GeneTreeiENSGT00980000198495
HOGENOMiHOG000070028
InParanoidiQ8TD07
KOiK07987
OMAiSLPDTWI
OrthoDBi1092787at2759
PhylomeDBiQ8TD07
TreeFamiTF339658

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RAET1E

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		135250
PharosiQ8TD07 Tbio

Protein Ontology

More...PROi		PR:Q8TD07
RNActiQ8TD07 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000164520 Expressed in 90 organ(s), highest expression level in ectocervix
ExpressionAtlasiQ8TD07 baseline and differential
GenevisibleiQ8TD07 HS

Family and domain databases

Gene3Di3.30.500.10, 1 hit
InterProiView protein in InterPro
IPR011161 MHC_I-like_Ag-recog
IPR037055 MHC_I-like_Ag-recog_sf
IPR011162 MHC_I/II-like_Ag-recog
PfamiView protein in Pfam
PF00129 MHC_I, 1 hit
SUPFAMiSSF54452 SSF54452, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRAE1E_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TD07
Secondary accession number(s): A6YF59
, Q5VYB7, Q5VYB8, Q8TEZ2, Q96L41
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: June 1, 2002
Last modified: December 11, 2019
This is version 152 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again