Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 117 (08 May 2019)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cytoplasmic dynein 2 light intermediate chain 1

Gene

DYNC2LI1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for correct intraflagellar transport (IFT), the bi-directional movement of particles required for the assembly, maintenance and functioning of primary cilia. Involved in the regulation of ciliary length.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • dynein heavy chain binding Source: GO_Central
  • motor activity Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Motor protein
Biological processCilium biogenesis/degradation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5620924 Intraflagellar transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytoplasmic dynein 2 light intermediate chain 1
Short name:
Dynein 2 light intermediate chain
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DYNC2LI1
Synonyms:D2LIC, LIC3
ORF Names:CGI-60
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24595 DYNC2LI1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617083 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TCX1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Short-rib thoracic dysplasia 15 with polydactyly (SRTD15)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of short-rib thoracic dysplasia, a group of autosomal recessive ciliopathies that are characterized by a constricted thoracic cage, short ribs, shortened tubular bones, and a 'trident' appearance of the acetabular roof. Polydactyly is variably present. Non-skeletal involvement can include cleft lip/palate as well as anomalies of major organs such as the brain, eye, heart, kidneys, liver, pancreas, intestines, and genitalia. Some forms of the disease are lethal in the neonatal period due to respiratory insufficiency secondary to a severely restricted thoracic cage, whereas others are compatible with life. Disease spectrum encompasses Ellis-van Creveld syndrome, asphyxiating thoracic dystrophy (Jeune syndrome), Mainzer-Saldino syndrome, and short rib-polydactyly syndrome.
See also OMIM:617088
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_077814117L → V in SRTD15. 1 PublicationCorresponds to variant dbSNP:rs201948500EnsemblClinVar.1
Natural variantiVAR_077815220T → I in SRTD15. 1 PublicationCorresponds to variant dbSNP:rs886037860Ensembl.1

Keywords - Diseasei

Ciliopathy, Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
51626

MalaCards human disease database

More...
MalaCardsi
DYNC2LI1
MIMi617088 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000138036

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
289 Ellis Van Creveld syndrome
474 Jeune syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671919

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DYNC2LI1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74715850

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003187501 – 351Cytoplasmic dynein 2 light intermediate chain 1Add BLAST351

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TCX1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TCX1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TCX1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TCX1

PeptideAtlas

More...
PeptideAtlasi
Q8TCX1

PRoteomics IDEntifications database

More...
PRIDEi
Q8TCX1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74183
74184 [Q8TCX1-2]
74185 [Q8TCX1-3]
74186 [Q8TCX1-4]
74187 [Q8TCX1-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TCX1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TCX1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in bone, brain, kidney, and cartilage (PubMed:26077881, PubMed:26130459). Lower expression in heart, liver, lung, placenta and thymus (PubMed:26077881).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138036 Expressed in 228 organ(s), highest expression level in caudate nucleus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TCX1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TCX1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA062905

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The cytoplasmic dynein complex 2 is probably composed by a DYNC2H1 homodimer and a number of DYNC2LI1 light intermediate chains.By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
SOD1P004413EBI-8568003,EBI-990792

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119644, 23 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8TCX1

Protein interaction database and analysis system

More...
IntActi
Q8TCX1, 12 interactors

Molecular INTeraction database

More...
MINTi
Q8TCX1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000474032

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3929 Eukaryota
ENOG410XTE5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000010498

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TCX1

KEGG Orthology (KO)

More...
KOi
K10417

Identification of Orthologs from Complete Genome Data

More...
OMAi
PAKDPQY

Database of Orthologous Groups

More...
OrthoDBi
910690at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TCX1

TreeFam database of animal gene trees

More...
TreeFami
TF314138

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040045 DYNC2LI1
IPR022780 Dynein_light_int_chain
IPR027417 P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR13236 PTHR13236, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05783 DLIC, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TCX1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSETLWEIA KAEVEKRGIN GSEGDGAEIA EKFVFFIGSK NGGKTTIILR
60 70 80 90 100
CLDRDEPPKP TLALEYTYGR RAKGHNTPKD IAHFWELGGG TSLLDLISIP
110 120 130 140 150
ITGDTLRTFS LVLVLDLSKP NDLWPTMENL LQATKSHVDK VIMKLGKTNA
160 170 180 190 200
KAVSEMRQKI WNNMPKDHPD HELIDPFPVP LVIIGSKYDV FQDFESEKRK
210 220 230 240 250
VICKTLRFVA HYYGASLMFT SKSEALLLKI RGVINQLAFG IDKSKSICVD
260 270 280 290 300
QNKPLFITAG LDSFGQIGSP PVPENDIGKL HAHSPMELWK KVYEKLFPPK
310 320 330 340 350
SINTLKDIKD PARDPQYAEN EVDEMRIQKD LELEQYKRSS SKSWKQIELD

S
Length:351
Mass (Da):39,625
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBB4BB8B528D4A99A
GO
Isoform 2 (identifier: Q8TCX1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: P → PQ

Show »
Length:352
Mass (Da):39,753
Checksum:i156B9FAB4FDABAC1
GO
Isoform 3 (identifier: Q8TCX1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     332-351: ELEQYKRSSSKSWKQIELDS → VLS

Show »
Length:334
Mass (Da):37,500
Checksum:iC4D1D8FF4A49656F
GO
Isoform 4 (identifier: Q8TCX1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-201: DHELIDPFPVPLVIIGSKYDVFQDFESEKRKV → VSCCLGLLLESLVPFIVNDNITNNFFRFLCMT
     202-351: Missing.

Show »
Length:201
Mass (Da):22,433
Checksum:i88D40AFF3FB35E50
GO
Isoform 5 (identifier: Q8TCX1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-144: TFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMK → SWQLSSLLPVSMNLTTPVPHINEIIHYLSFCYLFHLA
     145-351: Missing.

Note: No experimental confirmation available.
Show »
Length:144
Mass (Da):15,997
Checksum:i4A235A2C5B2D1F15
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BYC8H7BYC8_HUMAN
Cytoplasmic dynein 2 light intermed...
DYNC2LI1
318Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJK4E5RJK4_HUMAN
Cytoplasmic dynein 2 light intermed...
DYNC2LI1
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFM8E5RFM8_HUMAN
Cytoplasmic dynein 2 light intermed...
DYNC2LI1
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RK97E5RK97_HUMAN
Cytoplasmic dynein 2 light intermed...
DYNC2LI1
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD34055 differs from that shown. Reason: Frameshift at positions 163 and 167.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29I → F in CAB43233 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03887433F → S2 PublicationsCorresponds to variant dbSNP:rs2288709Ensembl.1
Natural variantiVAR_03887558P → S1 PublicationCorresponds to variant dbSNP:rs17854966Ensembl.1
Natural variantiVAR_077814117L → V in SRTD15. 1 PublicationCorresponds to variant dbSNP:rs201948500EnsemblClinVar.1
Natural variantiVAR_077815220T → I in SRTD15. 1 PublicationCorresponds to variant dbSNP:rs886037860Ensembl.1
Natural variantiVAR_038876230I → L2 PublicationsCorresponds to variant dbSNP:rs11556157Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_031287108 – 144TFSLV…KVIMK → SWQLSSLLPVSMNLTTPVPH INEIIHYLSFCYLFHLA in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_031288145 – 351Missing in isoform 5. 1 PublicationAdd BLAST207
Alternative sequenceiVSP_031289169P → PQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_031290170 – 201DHELI…EKRKV → VSCCLGLLLESLVPFIVNDN ITNNFFRFLCMT in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_031291202 – 351Missing in isoform 4. 1 PublicationAdd BLAST150
Alternative sequenceiVSP_031292332 – 351ELEQY…IELDS → VLS in isoform 3. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY083346 mRNA Translation: AAL99216.1
AF151818 mRNA Translation: AAD34055.1 Frameshift.
AK223432 mRNA Translation: BAD97152.1
AC011242 Genomic DNA Translation: AAY14702.1
CH471053 Genomic DNA Translation: EAX00289.1
CH471053 Genomic DNA Translation: EAX00290.1
CH471053 Genomic DNA Translation: EAX00291.1
BC006969 mRNA Translation: AAH06969.1
BC016324 mRNA Translation: AAH16324.1
BC040558 mRNA Translation: AAH40558.1
BC058823 mRNA Translation: AAH58823.1
AL050006 mRNA Translation: CAB43233.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1813.1 [Q8TCX1-1]
CCDS46270.1 [Q8TCX1-4]
CCDS62903.1 [Q8TCX1-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T08695

NCBI Reference Sequences

More...
RefSeqi
NP_001180393.1, NM_001193464.1 [Q8TCX1-2]
NP_056337.1, NM_015522.3 [Q8TCX1-4]
NP_057092.2, NM_016008.3 [Q8TCX1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000260605; ENSP00000260605; ENSG00000138036 [Q8TCX1-1]
ENST00000398823; ENSP00000381804; ENSG00000138036 [Q8TCX1-5]
ENST00000406852; ENSP00000385738; ENSG00000138036 [Q8TCX1-4]
ENST00000605786; ENSP00000474032; ENSG00000138036 [Q8TCX1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51626

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51626

UCSC genome browser

More...
UCSCi
uc002rth.4 human [Q8TCX1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY083346 mRNA Translation: AAL99216.1
AF151818 mRNA Translation: AAD34055.1 Frameshift.
AK223432 mRNA Translation: BAD97152.1
AC011242 Genomic DNA Translation: AAY14702.1
CH471053 Genomic DNA Translation: EAX00289.1
CH471053 Genomic DNA Translation: EAX00290.1
CH471053 Genomic DNA Translation: EAX00291.1
BC006969 mRNA Translation: AAH06969.1
BC016324 mRNA Translation: AAH16324.1
BC040558 mRNA Translation: AAH40558.1
BC058823 mRNA Translation: AAH58823.1
AL050006 mRNA Translation: CAB43233.1
CCDSiCCDS1813.1 [Q8TCX1-1]
CCDS46270.1 [Q8TCX1-4]
CCDS62903.1 [Q8TCX1-2]
PIRiT08695
RefSeqiNP_001180393.1, NM_001193464.1 [Q8TCX1-2]
NP_056337.1, NM_015522.3 [Q8TCX1-4]
NP_057092.2, NM_016008.3 [Q8TCX1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi119644, 23 interactors
CORUMiQ8TCX1
IntActiQ8TCX1, 12 interactors
MINTiQ8TCX1
STRINGi9606.ENSP00000474032

PTM databases

iPTMnetiQ8TCX1
PhosphoSitePlusiQ8TCX1

Polymorphism and mutation databases

BioMutaiDYNC2LI1
DMDMi74715850

Proteomic databases

EPDiQ8TCX1
jPOSTiQ8TCX1
MaxQBiQ8TCX1
PaxDbiQ8TCX1
PeptideAtlasiQ8TCX1
PRIDEiQ8TCX1
ProteomicsDBi74183
74184 [Q8TCX1-2]
74185 [Q8TCX1-3]
74186 [Q8TCX1-4]
74187 [Q8TCX1-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51626
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000260605; ENSP00000260605; ENSG00000138036 [Q8TCX1-1]
ENST00000398823; ENSP00000381804; ENSG00000138036 [Q8TCX1-5]
ENST00000406852; ENSP00000385738; ENSG00000138036 [Q8TCX1-4]
ENST00000605786; ENSP00000474032; ENSG00000138036 [Q8TCX1-2]
GeneIDi51626
KEGGihsa:51626
UCSCiuc002rth.4 human [Q8TCX1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51626
DisGeNETi51626

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DYNC2LI1
HGNCiHGNC:24595 DYNC2LI1
HPAiHPA062905
MalaCardsiDYNC2LI1
MIMi617083 gene
617088 phenotype
neXtProtiNX_Q8TCX1
OpenTargetsiENSG00000138036
Orphaneti289 Ellis Van Creveld syndrome
474 Jeune syndrome
PharmGKBiPA142671919

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3929 Eukaryota
ENOG410XTE5 LUCA
GeneTreeiENSGT00390000010498
InParanoidiQ8TCX1
KOiK10417
OMAiPAKDPQY
OrthoDBi910690at2759
PhylomeDBiQ8TCX1
TreeFamiTF314138

Enzyme and pathway databases

ReactomeiR-HSA-5620924 Intraflagellar transport

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DYNC2LI1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51626

Protein Ontology

More...
PROi
PR:Q8TCX1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138036 Expressed in 228 organ(s), highest expression level in caudate nucleus
ExpressionAtlasiQ8TCX1 baseline and differential
GenevisibleiQ8TCX1 HS

Family and domain databases

InterProiView protein in InterPro
IPR040045 DYNC2LI1
IPR022780 Dynein_light_int_chain
IPR027417 P-loop_NTPase
PANTHERiPTHR13236 PTHR13236, 1 hit
PfamiView protein in Pfam
PF05783 DLIC, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDC2L1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TCX1
Secondary accession number(s): A8MVJ5
, Q53F57, Q6PDB2, Q8IWA3, Q96B03, Q96J00, Q9Y370, Q9Y3S9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: June 1, 2002
Last modified: May 8, 2019
This is version 117 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again