Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q8TCT9 (HM13_HUMAN)

Entry version 183 (25 May 2022)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Minor histocompatibility antigen H13

Gene

HM13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides (PubMed:11714810).

May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein (PubMed:12145199).

Involved in the intramembrane cleavage of the integral membrane protein PSEN1 (PubMed:12077416, PubMed:11714810, PubMed:14741365).

Cleaves the integral membrane protein XBP1 isoform 1 in a DERL1/RNF139-dependent manner (PubMed:25239945).

May play a role in graft rejection (By similarity).

By similarity5 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei219By similarity1
Active sitei265By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8TCT9

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-9707587, Regulation of HMOX1 expression and activity

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q8TCT9

Protein family/group databases

MEROPS protease database

More...MEROPSi		A22.003

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Minor histocompatibility antigen H13 (EC:3.4.23.-)
Alternative name(s):
Intramembrane protease 1
Short name:
IMP-1
Short name:
IMPAS-1
Short name:
hIMP1
Presenilin-like protein 3
Signal peptide peptidase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HM13
Synonyms:H13, IMP1, PSL3, SPP
ORF Names:MSTP086
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:16435, HM13

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607106, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8TCT9

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000101294

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 31Lumenal2 PublicationsAdd BLAST31
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei32 – 52HelicalSequence analysisAdd BLAST21
Topological domaini53 – 77CytoplasmicSequence analysisAdd BLAST25
Transmembranei78 – 98HelicalSequence analysisAdd BLAST21
Topological domaini99 – 100LumenalSequence analysis2
Transmembranei101 – 121HelicalSequence analysisAdd BLAST21
Topological domaini122 – 157CytoplasmicSequence analysisAdd BLAST36
Transmembranei158 – 178HelicalSequence analysisAdd BLAST21
Topological domaini179 – 181LumenalSequence analysis3
Transmembranei182 – 202HelicalSequence analysisAdd BLAST21
Topological domaini203 – 209CytoplasmicSequence analysis7
Transmembranei210 – 230HelicalSequence analysisAdd BLAST21
Topological domaini231 – 256Lumenal1 PublicationAdd BLAST26
Transmembranei257 – 277HelicalSequence analysisAdd BLAST21
Topological domaini278 – 290CytoplasmicSequence analysisAdd BLAST13
Transmembranei291 – 311HelicalSequence analysisAdd BLAST21
Topological domaini312 – 314LumenalSequence analysis3
Transmembranei315 – 335HelicalSequence analysisAdd BLAST21
Topological domaini336 – 377Cytoplasmic1 PublicationAdd BLAST42

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi10N → Q: Abolishes N-glycosylation; when associated with Q-20. 1 Publication1
Mutagenesisi20N → Q: Abolishes N-glycosylation; when associated with Q-10. 1 Publication1
Mutagenesisi219D → A: Abolishes proteolysis of PSEN1. 1 Publication1
Mutagenesisi264G → A: No effect on proteolysis of PSEN1. 1 Publication1
Mutagenesisi265D → A: No effect on inhibitor binding; abolishes catalytic activity. Abolishes proteolysis of PSEN1. Abolishes proteolysis of XBP1 isoform 1 and increases interaction with XBP1 isoform 1. 3 Publications1
Mutagenesisi317P → L: Abolishes proteolysis of PSEN1. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		81502

Open Targets

More...OpenTargetsi		ENSG00000101294

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29314

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8TCT9, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4523407

Drug and drug target database

More...DrugBanki		DB00277, Theophylline

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HM13

Domain mapping of disease mutations (DMDM)

More...DMDMi		25008563

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000739071 – 377Minor histocompatibility antigen H13Add BLAST377

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi10N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi20N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei367PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.3 Publications

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-1612

Encyclopedia of Proteome Dynamics

More...EPDi		Q8TCT9

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8TCT9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8TCT9

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8TCT9

PeptideAtlas

More...PeptideAtlasi		Q8TCT9

PRoteomics IDEntifications database

More...PRIDEi		Q8TCT9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		74165 [Q8TCT9-1]
74166 [Q8TCT9-2]
74167 [Q8TCT9-4]
74168 [Q8TCT9-5]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q8TCT9-1 [Q8TCT9-1]
Q8TCT9-5 [Q8TCT9-5]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8TCT9, 3 sites, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8TCT9

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q8TCT9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8TCT9

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8TCT9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in kidney, liver, placenta, lung, leukocytes and small intestine and reduced expression in heart and skeletal muscle. Expressed abundantly in the CNS with highest levels in thalamus and medulla.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000101294, Expressed in muscle tissue and 214 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8TCT9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8TCT9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000101294, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (PubMed:15385547, PubMed:15998642). Homodimer (PubMed:15385547, PubMed:15998642).

Interacts with RNF139 (PubMed:19720873, PubMed:25239945).

Interacts with DERL1 and XBP1 isoform 1 (PubMed:25239945).

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		123505, 131 interactors

Protein interaction database and analysis system

More...IntActi		Q8TCT9, 44 interactors

Molecular INTeraction database

More...MINTi		Q8TCT9

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8TCT9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q8TCT9

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 27DisorderedSequence analysisAdd BLAST27
Regioni345 – 377DisorderedSequence analysisAdd BLAST33

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi317 – 319PAL3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi13 – 27Polar residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The first transmembrane domain may act as a type I signal anchor (PubMed:12077416, PubMed:15385547). The PAL motif is required for normal active site conformation (By similarity).By similarity2 Publications

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase A22B family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156478

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_023799_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8TCT9

Identification of Orthologs from Complete Genome Data

More...OMAi		LFSYEDH

Database of Orthologous Groups

More...OrthoDBi		1087991at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8TCT9

TreeFam database of animal gene trees

More...TreeFami		TF105854

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007369, Peptidase_A22B_SPP
IPR006639, Preselin/SPP

The PANTHER Classification System

More...PANTHERi		PTHR12174, PTHR12174, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04258, Peptidase_A22B, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00730, PSN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TCT9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSALSDPHN GSAEAGGPTN STTRPPSTPE GIALAYGSLL LMALLPIFFG 
        60         70         80         90        100
ALRSVRCARG KNASDMPETI TSRDAARFPI IASCTLLGLY LFFKIFSQEY 
       110        120        130        140        150
INLLLSMYFF VLGILALSHT ISPFMNKFFP ASFPNRQYQL LFTQGSGENK 
       160        170        180        190        200
EEIINYEFDT KDLVCLGLSS IVGVWYLLRK HWIANNLFGL AFSLNGVELL 
       210        220        230        240        250
HLNNVSTGCI LLGGLFIYDV FWVFGTNVMV TVAKSFEAPI KLVFPQDLLE 
       260        270        280        290        300
KGLEANNFAM LGLGDVVIPG IFIALLLRFD ISLKKNTHTY FYTSFAAYIF 
       310        320        330        340        350
GLGLTIFIMH IFKHAQPALL YLVPACIGFP VLVALAKGEV TEMFSYEESN 
       360        370 
PKDPAAVTES KEGTEASASK GLEKKEK
Length:377
Mass (Da):41,488
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i322D231B52B33118
GO
Isoform 2 (identifier: Q8TCT9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-347: E → ESSAEILPHTPRLTHFPTVSGSPASLADSMQQKLAGPRRRRPQNPSAIYE

Show »
Length:426
Mass (Da):46,825
Checksum:i269AD5CC99982845
GO
Isoform 4 (identifier: Q8TCT9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-377: ESNPKDPAAVTESKEGTEASASKGLEKKEK → SSAEILPHTP...RRRPQNPSAM

Show »
Length:394
Mass (Da):43,423
Checksum:i9BEC3A1C9B605D48
GO
Isoform 5 (identifier: Q8TCT9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     181-222: Missing.

Show »
Length:335
Mass (Da):36,814
Checksum:iD22777AF67B3720B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B3IUB5A0A3B3IUB5_HUMAN
Minor histocompatibility antigen H1...
HM13
420Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A075B6F6A0A075B6F6_HUMAN
Minor histocompatibility antigen H1...
HM13
272Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0S2Z6F0A0A0S2Z6F0_HUMAN
Histocompatibility 13 isoform 2
HM13
345Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IT72A0A3B3IT72_HUMAN
Minor histocompatibility antigen H1...
HM13
365Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGU3A0A0C4DGU3_HUMAN
Minor histocompatibility antigen H1...
HM13
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WVH6A0A087WVH6_HUMAN
Minor histocompatibility antigen H1...
HM13
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ13609 differs from that shown. Reason: Frameshift.Curated
The sequence BAC11138 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti132S → N AA sequence (PubMed:12077416).Curated1
Sequence conflicti150K → R in BAC11519 (PubMed:14702039).Curated1
Sequence conflicti159D → A AA sequence (PubMed:12077416).Curated1
Sequence conflicti235S → F in AAH08938 (PubMed:15489334).Curated1
Sequence conflicti235S → F in AAH08959 (PubMed:15489334).Curated1
Sequence conflicti295F → Y in AAQ13609 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_014274259A → P. Corresponds to variant dbSNP:rs1044419Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_015082181 – 222Missing in isoform 5. CuratedAdd BLAST42
Alternative sequenceiVSP_005196347E → ESSAEILPHTPRLTHFPTVS GSPASLADSMQQKLAGPRRR RPQNPSAIYE in isoform 2. 1 Publication1
Alternative sequenceiVSP_015083348 – 377ESNPK…EKKEK → SSAEILPHTPRLTHFPTVSG SPASLADSMQQKLAGPRRRR PQNPSAM in isoform 4. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ420895 mRNA Translation: CAD13132.1
AF515663 mRNA Translation: AAN77099.1
AY169310 mRNA Translation: AAO12535.1
AY169311 mRNA Translation: AAO12536.1
AY169312 mRNA Translation: AAO12537.1
DQ168450 mRNA Translation: ABA56163.1
AJ345029 mRNA Translation: CAC87790.1
AF483215 mRNA Translation: AAM22076.1
AF172086 mRNA Translation: AAQ13609.1 Frameshift.
AK074686 mRNA Translation: BAC11138.1 Sequence problems.
AK075283 mRNA Translation: BAC11519.1
AK314410 mRNA Translation: BAG37032.1
AL110115 Genomic DNA No translation available.
AL121751 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76436.1
CH471077 Genomic DNA Translation: EAW76437.1
CH471077 Genomic DNA Translation: EAW76435.1
CH471077 Genomic DNA Translation: EAW76438.1
BC008938 mRNA Translation: AAH08938.1
BC008959 mRNA Translation: AAH08959.1
BC062595 mRNA Translation: AAH62595.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13182.1 [Q8TCT9-1]
CCDS13183.1 [Q8TCT9-4]
CCDS42861.1 [Q8TCT9-2]

NCBI Reference Sequences

More...RefSeqi		NP_110416.1, NM_030789.3 [Q8TCT9-1]
NP_848695.1, NM_178580.2 [Q8TCT9-4]
NP_848696.1, NM_178581.2 [Q8TCT9-2]
NP_848697.1, NM_178582.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000335574.10; ENSP00000335294.5; ENSG00000101294.18 [Q8TCT9-4]
ENST00000340852.9; ENSP00000343032.5; ENSG00000101294.18
ENST00000398174.9; ENSP00000381237.3; ENSG00000101294.18 [Q8TCT9-2]
ENST00000674240.1; ENSP00000501423.1; ENSG00000101294.18 [Q8TCT9-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		81502

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:81502

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000398174.9; ENSP00000381237.3; NM_178581.3; NP_848696.1 [Q8TCT9-2]

UCSC genome browser

More...UCSCi		uc002wwb.3, human [Q8TCT9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ420895 mRNA Translation: CAD13132.1
AF515663 mRNA Translation: AAN77099.1
AY169310 mRNA Translation: AAO12535.1
AY169311 mRNA Translation: AAO12536.1
AY169312 mRNA Translation: AAO12537.1
DQ168450 mRNA Translation: ABA56163.1
AJ345029 mRNA Translation: CAC87790.1
AF483215 mRNA Translation: AAM22076.1
AF172086 mRNA Translation: AAQ13609.1 Frameshift.
AK074686 mRNA Translation: BAC11138.1 Sequence problems.
AK075283 mRNA Translation: BAC11519.1
AK314410 mRNA Translation: BAG37032.1
AL110115 Genomic DNA No translation available.
AL121751 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76436.1
CH471077 Genomic DNA Translation: EAW76437.1
CH471077 Genomic DNA Translation: EAW76435.1
CH471077 Genomic DNA Translation: EAW76438.1
BC008938 mRNA Translation: AAH08938.1
BC008959 mRNA Translation: AAH08959.1
BC062595 mRNA Translation: AAH62595.1
CCDSiCCDS13182.1 [Q8TCT9-1]
CCDS13183.1 [Q8TCT9-4]
CCDS42861.1 [Q8TCT9-2]
RefSeqiNP_110416.1, NM_030789.3 [Q8TCT9-1]
NP_848695.1, NM_178580.2 [Q8TCT9-4]
NP_848696.1, NM_178581.2 [Q8TCT9-2]
NP_848697.1, NM_178582.2

3D structure databases

AlphaFoldDBiQ8TCT9
ModBaseiSearch...
SWISS-MODEL-WorkspaceiSubmit a new modelling project...

Protein-protein interaction databases

BioGRIDi123505, 131 interactors
IntActiQ8TCT9, 44 interactors
MINTiQ8TCT9

Chemistry databases

ChEMBLiCHEMBL4523407
DrugBankiDB00277, Theophylline

Protein family/group databases

MEROPSiA22.003

PTM databases

GlyGeniQ8TCT9, 3 sites, 1 O-linked glycan (1 site)
iPTMnetiQ8TCT9
MetOSiteiQ8TCT9
PhosphoSitePlusiQ8TCT9
SwissPalmiQ8TCT9

Genetic variation databases

BioMutaiHM13
DMDMi25008563

Proteomic databases

CPTACiCPTAC-1612
EPDiQ8TCT9
jPOSTiQ8TCT9
MassIVEiQ8TCT9
MaxQBiQ8TCT9
PeptideAtlasiQ8TCT9
PRIDEiQ8TCT9
ProteomicsDBi74165 [Q8TCT9-1]
74166 [Q8TCT9-2]
74167 [Q8TCT9-4]
74168 [Q8TCT9-5]
TopDownProteomicsiQ8TCT9-1 [Q8TCT9-1]
Q8TCT9-5 [Q8TCT9-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		25181, 139 antibodies from 22 providers

The DNASU plasmid repository

More...DNASUi		81502

Genome annotation databases

EnsembliENST00000335574.10; ENSP00000335294.5; ENSG00000101294.18 [Q8TCT9-4]
ENST00000340852.9; ENSP00000343032.5; ENSG00000101294.18
ENST00000398174.9; ENSP00000381237.3; ENSG00000101294.18 [Q8TCT9-2]
ENST00000674240.1; ENSP00000501423.1; ENSG00000101294.18 [Q8TCT9-4]
GeneIDi81502
KEGGihsa:81502
MANE-SelectiENST00000398174.9; ENSP00000381237.3; NM_178581.3; NP_848696.1 [Q8TCT9-2]
UCSCiuc002wwb.3, human [Q8TCT9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		81502
DisGeNETi81502

GeneCards: human genes, protein and diseases

More...GeneCardsi		HM13
HGNCiHGNC:16435, HM13
HPAiENSG00000101294, Low tissue specificity
MIMi607106, gene
neXtProtiNX_Q8TCT9
OpenTargetsiENSG00000101294
PharmGKBiPA29314
VEuPathDBiHostDB:ENSG00000101294

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000156478
HOGENOMiCLU_023799_0_0_1
InParanoidiQ8TCT9
OMAiLFSYEDH
OrthoDBi1087991at2759
PhylomeDBiQ8TCT9
TreeFamiTF105854

Enzyme and pathway databases

PathwayCommonsiQ8TCT9
ReactomeiR-HSA-9707587, Regulation of HMOX1 expression and activity
SignaLinkiQ8TCT9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		81502, 38 hits in 1079 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		HM13, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		HM13

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		81502
PharosiQ8TCT9, Tbio

Protein Ontology

More...PROi		PR:Q8TCT9
RNActiQ8TCT9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000101294, Expressed in muscle tissue and 214 other tissues
ExpressionAtlasiQ8TCT9, baseline and differential
GenevisibleiQ8TCT9, HS

Family and domain databases

InterProiView protein in InterPro
IPR007369, Peptidase_A22B_SPP
IPR006639, Preselin/SPP
PANTHERiPTHR12174, PTHR12174, 1 hit
PfamiView protein in Pfam
PF04258, Peptidase_A22B, 1 hit
SMARTiView protein in SMART
SM00730, PSN, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHM13_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TCT9
Secondary accession number(s): B2RAY5
, E1P5L3, Q15K36, Q540H8, Q5JWP2, Q5JWP3, Q5JWP4, Q5JWP5, Q7Z4F2, Q86Y35, Q95H87, Q9H110, Q9H111
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: June 1, 2002
Last modified: May 25, 2022
This is version 183 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again