Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein L30, mitochondrial

Gene

MRPL30

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRibonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein L30, mitochondrial
Short name:
L30mt
Short name:
MRP-L30
Alternative name(s):
39S ribosomal protein L28, mitochondrial
Short name:
L28mt
Short name:
MRP-L28
Mitochondrial large ribosomal subunit protein uL30m1 Publication
Gene namesi
Name:MRPL30
Synonyms:MRPL28, RPML28
ORF Names:HSPC249
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000185414.19
HGNCiHGNC:14036 MRPL30
MIMi611838 gene
neXtProtiNX_Q8TCC3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000185414
PharmGKBiPA30961

Polymorphism and mutation databases

BioMutaiMRPL30
DMDMi74730583

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 34MitochondrionBy similarityAdd BLAST34
ChainiPRO_000026164935 – 16139S ribosomal protein L30, mitochondrialAdd BLAST127

Proteomic databases

EPDiQ8TCC3
MaxQBiQ8TCC3
PaxDbiQ8TCC3
PeptideAtlasiQ8TCC3
PRIDEiQ8TCC3
ProteomicsDBi74113
74114 [Q8TCC3-2]
74115 [Q8TCC3-3]
TopDownProteomicsiQ8TCC3-1 [Q8TCC3-1]
Q8TCC3-2 [Q8TCC3-2]
Q8TCC3-3 [Q8TCC3-3]

PTM databases

GlyConnecti982
iPTMnetiQ8TCC3
PhosphoSitePlusiQ8TCC3

Expressioni

Gene expression databases

BgeeiENSG00000185414 Expressed in 200 organ(s), highest expression level in deltoid
CleanExiHS_MRPL28
HS_MRPL30
ExpressionAtlasiQ8TCC3 baseline and differential
GenevisibleiQ8TCC3 HS

Organism-specific databases

HPAiHPA047255

Interactioni

Subunit structurei

Component of the mitochondrial large ribosomal subunit (mt-LSU) (PubMed:28892042, PubMed:25838379, PubMed:25278503). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins.3 Publications

Protein-protein interaction databases

BioGridi119417, 81 interactors
CORUMiQ8TCC3
IntActiQ8TCC3, 4 interactors
STRINGi9606.ENSP00000420959

Structurei

Secondary structure

1161
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8TCC3
SMRiQ8TCC3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG4799 Eukaryota
ENOG4111TYH LUCA
GeneTreeiENSGT00390000016769
HOVERGENiHBG082601
InParanoidiQ8TCC3
KOiK02907
OMAiEQPHKLH
OrthoDBiEOG091G0LCK
PhylomeDBiQ8TCC3
TreeFamiTF314611

Family and domain databases

CDDicd01658 Ribosomal_L30, 1 hit
Gene3Di3.30.1390.20, 1 hit
InterProiView protein in InterPro
IPR036919 L30_ferredoxin-like_sf
IPR005996 Ribosomal_L30_bac-type
IPR016082 Ribosomal_L30_ferredoxin-like
PANTHERiPTHR15892 PTHR15892, 1 hit
PfamiView protein in Pfam
PF00327 Ribosomal_L30, 1 hit
SUPFAMiSSF55129 SSF55129, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TCC3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGILRLVVQ WPPGRLQTVT KGVESLICTD WIRHKFTRSR IPEKVFQASP
60 70 80 90 100
EDHEKYGGDP QNPHKLHIVT RIKSTRRRPY WEKDIIKMLG LEKAHTPQVH
110 120 130 140 150
KNIPSVNAKL KVVKHLIRIK PLKLPQGLPA EENMSNTCLK STGELVVQWH
160
LKPVEQKAHE S
Length:161
Mass (Da):18,546
Last modified:June 1, 2002 - v1
Checksum:iE818AD8B8AA7DD23
GO
Isoform 2 (identifier: Q8TCC3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSSTLGKLSNQVEETLPLLKKPLKRAITTLM

Note: No experimental confirmation available.
Show »
Length:191
Mass (Da):21,839
Checksum:i98159061F494ABD5
GO
Isoform 3 (identifier: Q8TCC3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     119-161: IKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES → FVVSSQLFLKCIA

Note: No experimental confirmation available.
Show »
Length:131
Mass (Da):15,191
Checksum:i0CCC141A971552CE
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZZV5B8ZZV5_HUMAN
39S ribosomal protein L30, mitochon...
MRPL30
101Annotation score:

Sequence cautioni

The sequence AAF36169 differs from that shown. Reason: Frameshift at positions 1 and 36.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti45V → A in BAC86542 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034462130A → T3 PublicationsCorresponds to variant dbSNP:rs1044575Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0217461M → MSSTLGKLSNQVEETLPLLK KPLKRAITTLM in isoform 2. 1 Publication1
Alternative sequenceiVSP_021747119 – 161IKPLK…KAHES → FVVSSQLFLKCIA in isoform 3. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151083 mRNA Translation: AAF36169.1 Frameshift.
AK126402 mRNA Translation: BAC86542.1
AC092587 Genomic DNA Translation: AAX88929.1
CH471127 Genomic DNA Translation: EAX01876.1
CH471127 Genomic DNA Translation: EAX01878.1
CH471127 Genomic DNA Translation: EAX01880.1
CH471127 Genomic DNA Translation: EAX01881.1
CH471127 Genomic DNA Translation: EAX01882.1
CH471127 Genomic DNA Translation: EAX01883.1
BC000217 mRNA Translation: AAH00217.1
BC022391 mRNA Translation: AAH22391.1
AB051342 Genomic DNA Translation: BAB54932.1
CCDSiCCDS2041.1 [Q8TCC3-1]
RefSeqiNP_660213.1, NM_145212.3 [Q8TCC3-1]
UniGeneiHs.346736

Genome annotation databases

EnsembliENST00000338148; ENSP00000338057; ENSG00000185414 [Q8TCC3-1]
ENST00000409841; ENSP00000386752; ENSG00000185414 [Q8TCC3-1]
GeneIDi51263
KEGGihsa:51263
UCSCiuc002szv.4 human [Q8TCC3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151083 mRNA Translation: AAF36169.1 Frameshift.
AK126402 mRNA Translation: BAC86542.1
AC092587 Genomic DNA Translation: AAX88929.1
CH471127 Genomic DNA Translation: EAX01876.1
CH471127 Genomic DNA Translation: EAX01878.1
CH471127 Genomic DNA Translation: EAX01880.1
CH471127 Genomic DNA Translation: EAX01881.1
CH471127 Genomic DNA Translation: EAX01882.1
CH471127 Genomic DNA Translation: EAX01883.1
BC000217 mRNA Translation: AAH00217.1
BC022391 mRNA Translation: AAH22391.1
AB051342 Genomic DNA Translation: BAB54932.1
CCDSiCCDS2041.1 [Q8TCC3-1]
RefSeqiNP_660213.1, NM_145212.3 [Q8TCC3-1]
UniGeneiHs.346736

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40Z1-161[»]
3J9Melectron microscopy3.50Z1-161[»]
5OOLelectron microscopy3.06Z1-161[»]
5OOMelectron microscopy3.03Z1-161[»]
ProteinModelPortaliQ8TCC3
SMRiQ8TCC3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119417, 81 interactors
CORUMiQ8TCC3
IntActiQ8TCC3, 4 interactors
STRINGi9606.ENSP00000420959

PTM databases

GlyConnecti982
iPTMnetiQ8TCC3
PhosphoSitePlusiQ8TCC3

Polymorphism and mutation databases

BioMutaiMRPL30
DMDMi74730583

Proteomic databases

EPDiQ8TCC3
MaxQBiQ8TCC3
PaxDbiQ8TCC3
PeptideAtlasiQ8TCC3
PRIDEiQ8TCC3
ProteomicsDBi74113
74114 [Q8TCC3-2]
74115 [Q8TCC3-3]
TopDownProteomicsiQ8TCC3-1 [Q8TCC3-1]
Q8TCC3-2 [Q8TCC3-2]
Q8TCC3-3 [Q8TCC3-3]

Protocols and materials databases

DNASUi51263
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338148; ENSP00000338057; ENSG00000185414 [Q8TCC3-1]
ENST00000409841; ENSP00000386752; ENSG00000185414 [Q8TCC3-1]
GeneIDi51263
KEGGihsa:51263
UCSCiuc002szv.4 human [Q8TCC3-1]

Organism-specific databases

CTDi51263
EuPathDBiHostDB:ENSG00000185414.19
GeneCardsiMRPL30
H-InvDBiHIX0077794
HGNCiHGNC:14036 MRPL30
HPAiHPA047255
MIMi611838 gene
neXtProtiNX_Q8TCC3
OpenTargetsiENSG00000185414
PharmGKBiPA30961
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4799 Eukaryota
ENOG4111TYH LUCA
GeneTreeiENSGT00390000016769
HOVERGENiHBG082601
InParanoidiQ8TCC3
KOiK02907
OMAiEQPHKLH
OrthoDBiEOG091G0LCK
PhylomeDBiQ8TCC3
TreeFamiTF314611

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Miscellaneous databases

ChiTaRSiMRPL30 human
GeneWikiiMRPL30
GenomeRNAii51263
PROiPR:Q8TCC3
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185414 Expressed in 200 organ(s), highest expression level in deltoid
CleanExiHS_MRPL28
HS_MRPL30
ExpressionAtlasiQ8TCC3 baseline and differential
GenevisibleiQ8TCC3 HS

Family and domain databases

CDDicd01658 Ribosomal_L30, 1 hit
Gene3Di3.30.1390.20, 1 hit
InterProiView protein in InterPro
IPR036919 L30_ferredoxin-like_sf
IPR005996 Ribosomal_L30_bac-type
IPR016082 Ribosomal_L30_ferredoxin-like
PANTHERiPTHR15892 PTHR15892, 1 hit
PfamiView protein in Pfam
PF00327 Ribosomal_L30, 1 hit
SUPFAMiSSF55129 SSF55129, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRM30_HUMAN
AccessioniPrimary (citable) accession number: Q8TCC3
Secondary accession number(s): A6NIC6
, D3DVI0, D3DVI3, Q0D2Q7, Q6ZTP4, Q96Q69, Q9P0N0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: June 1, 2002
Last modified: November 7, 2018
This is version 138 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Ribosomal proteins
    Ribosomal proteins families and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again