Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable E3 ubiquitin-protein ligase RNF217

Gene

RNF217

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.By similarity

Catalytic activityi

[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N6-ubiquitinyl-L-lysine.By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi263Zinc 1PROSITE-ProRule annotation1
Metal bindingi266Zinc 1PROSITE-ProRule annotation1
Metal bindingi283Zinc 1PROSITE-ProRule annotation1
Metal bindingi286Zinc 1PROSITE-ProRule annotation1
Metal bindingi383Zinc 2PROSITE-ProRule annotation1
Metal bindingi386Zinc 2PROSITE-ProRule annotation1
Metal bindingi391Zinc 2; via tele nitrogenPROSITE-ProRule annotation1
Metal bindingi396Zinc 2PROSITE-ProRule annotation1
Metal bindingi423Zinc 3PROSITE-ProRule annotation1
Metal bindingi426Zinc 3PROSITE-ProRule annotation1
Active sitei436PROSITE-ProRule annotation1
Metal bindingi441Zinc 3PROSITE-ProRule annotation1
Metal bindingi444Zinc 3PROSITE-ProRule annotation1
Metal bindingi449Zinc 4PROSITE-ProRule annotation1
Metal bindingi452Zinc 4PROSITE-ProRule annotation1
Metal bindingi465Zinc 4; via tele nitrogenPROSITE-ProRule annotation1
Metal bindingi474Zinc 4PROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri263 – 309RING-type 1PROSITE-ProRule annotationAdd BLAST47
Zinc fingeri328 – 396IBR-typePROSITE-ProRule annotationAdd BLAST69
Zinc fingeri423 – 452RING-type 2; atypicalPROSITE-ProRule annotationAdd BLAST30

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase RNF217 (EC:2.3.2.31By similarity)
Alternative name(s):
IBR domain-containing protein 1
RING finger protein 217
Gene namesi
Name:RNF217
Synonyms:C6orf172, IBRDC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000146373.16
HGNCiHGNC:21487 RNF217
neXtProtiNX_Q8TC41

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei503 – 523HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi154214
OpenTargetsiENSG00000146373
PharmGKBiPA162401868

Polymorphism and mutation databases

DMDMi313104196

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000841281 – 542Probable E3 ubiquitin-protein ligase RNF217Add BLAST542

Proteomic databases

EPDiQ8TC41
MaxQBiQ8TC41
PaxDbiQ8TC41
PeptideAtlasiQ8TC41
PRIDEiQ8TC41
ProteomicsDBi74087

PTM databases

iPTMnetiQ8TC41
PhosphoSitePlusiQ8TC41

Expressioni

Gene expression databases

BgeeiENSG00000146373 Expressed in 187 organ(s), highest expression level in corpus callosum
CleanExiHS_RNF217
ExpressionAtlasiQ8TC41 baseline and differential
GenevisibleiQ8TC41 HS

Organism-specific databases

HPAiHPA029598

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi127540, 6 interactors
STRINGi9606.ENSP00000352734

Structurei

3D structure databases

ProteinModelPortaliQ8TC41
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni259 – 478TRIAD supradomainPROSITE-ProRule annotationAdd BLAST220

Domaini

Members of the RBR family are atypical E3 ligases. They interact with the E2 conjugating enzyme UBE2L3 and function like HECT-type E3 enzymes: they bind E2s via the first RING domain, but require an obligate trans-thiolation step during the ubiquitin transfer, requiring a conserved cysteine residue in the second RING domain.By similarity

Sequence similaritiesi

Belongs to the RBR family. RNF217 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri263 – 309RING-type 1PROSITE-ProRule annotationAdd BLAST47
Zinc fingeri328 – 396IBR-typePROSITE-ProRule annotationAdd BLAST69
Zinc fingeri423 – 452RING-type 2; atypicalPROSITE-ProRule annotationAdd BLAST30

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG1815 Eukaryota
ENOG410XP9Y LUCA
GeneTreeiENSGT00730000111285
HOVERGENiHBG096781
InParanoidiQ8TC41
KOiK11977
OrthoDBiEOG091G0R5I
TreeFamiTF330860

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR031127 E3_UB_ligase_RBR
IPR002867 IBR_dom
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR11685 PTHR11685, 1 hit
PfamiView protein in Pfam
PF01485 IBR, 2 hits
SMARTiView protein in SMART
SM00647 IBR, 2 hits
PROSITEiView protein in PROSITE
PS51873 TRIAD, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TC41-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEEQSTVSG GGGPQESQTL ASGTAGHPEP PRPQGDSARA PPLRAASAEP
60 70 80 90 100
SGGGCGSDWG CADTSAPEPA RSLGPPGWSK SRAPAQPAGL ALTGPLNPQT
110 120 130 140 150
LPLQLELEEE EEEAGDRKEG GDEQQEAPPG EELEPRTRVG AADGLVLDVL
160 170 180 190 200
GQRRPSLAKR QVFCSVYCVE SDLPEAPASE QLSPPASPPG APPVLNPPST
210 220 230 240 250
RSSFPSPRLS LPTDSLSPDG GSIELEFYLA PEPFSMPSLL GAPPYSGLGG
260 270 280 290 300
VGDPYVPLMV LMCRVCLEDK PIKPLPCCKK AVCEECLKVY LSAQVQLGQV
310 320 330 340 350
EIKCPITECF EFLEETTVVY NLTHEDSIKY KYFLELGRID SSTKPCPQCK
360 370 380 390 400
HFTTFKKKGH IPTPSRSESK YKIQCPTCQF VWCFKCHSPW HEGVNCKEYK
410 420 430 440 450
KGDKLLRHWA SEIEHGQRNA QKCPKCKIHI QRTEGCDHMT CSQCNTNFCY
460 470 480 490 500
RCGERYRQLR FFGDHTSNLS IFGCKYRYLP ERPHLRRLVR GSVCAGKLFI
510 520 530 540
APLIMVLGLA LGAIAVVIGL FVFPIYCLCK KQRKRSRTGM HW
Note: No experimental confirmation available. Gene prediction based on partial mRNA and EST data.
Length:542
Mass (Da):59,372
Last modified:May 14, 2014 - v4
Checksum:i99A463D91873CC6E
GO
Isoform 2 (identifier: Q8TC41-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-294: MGEEQSTVSG...ECLKVYLSAQ → MK
     519-542: GLFVFPIYCLCKKQRKRSRTGMHW → VEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQVFICISYLLPL

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):31,981
Checksum:i8F783A7973859456
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YKH8H0YKH8_HUMAN
RBR-type E3 ubiquitin transferase
RNF217
306Annotation score:
E5RFY6E5RFY6_HUMAN
Probable E3 ubiquitin-protein ligas...
RNF217
104Annotation score:
H3BM17H3BM17_HUMAN
Probable E3 ubiquitin-protein ligas...
RNF217
65Annotation score:
H0YB95H0YB95_HUMAN
Probable E3 ubiquitin-protein ligas...
RNF217
78Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024160381V → I. Corresponds to variant dbSNP:rs475076Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0547051 – 294MGEEQ…YLSAQ → MK in isoform 2. 1 PublicationAdd BLAST294
Alternative sequenceiVSP_054706519 – 542GLFVF…TGMHW → VEEIKTYWNLISGRTRNQTQ HLAPQPVLLSDMLYCLKQVF ICISYLLPL in isoform 2. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136128 Genomic DNA No translation available.
AL355296 Genomic DNA No translation available.
BC026087 mRNA Translation: AAH26087.1
CCDSiCCDS5129.1 [Q8TC41-2]
CCDS69191.1 [Q8TC41-1]
RefSeqiNP_001273327.1, NM_001286398.2 [Q8TC41-1]
NP_689766.1, NM_152553.4 [Q8TC41-2]
UniGeneiHs.12876
Hs.368639
Hs.656715
Hs.661833

Genome annotation databases

EnsembliENST00000359704; ENSP00000352734; ENSG00000146373 [Q8TC41-2]
ENST00000521654; ENSP00000428698; ENSG00000146373 [Q8TC41-1]
GeneIDi154214
KEGGihsa:154214
UCSCiuc003pzr.5 human [Q8TC41-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136128 Genomic DNA No translation available.
AL355296 Genomic DNA No translation available.
BC026087 mRNA Translation: AAH26087.1
CCDSiCCDS5129.1 [Q8TC41-2]
CCDS69191.1 [Q8TC41-1]
RefSeqiNP_001273327.1, NM_001286398.2 [Q8TC41-1]
NP_689766.1, NM_152553.4 [Q8TC41-2]
UniGeneiHs.12876
Hs.368639
Hs.656715
Hs.661833

3D structure databases

ProteinModelPortaliQ8TC41
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127540, 6 interactors
STRINGi9606.ENSP00000352734

PTM databases

iPTMnetiQ8TC41
PhosphoSitePlusiQ8TC41

Polymorphism and mutation databases

DMDMi313104196

Proteomic databases

EPDiQ8TC41
MaxQBiQ8TC41
PaxDbiQ8TC41
PeptideAtlasiQ8TC41
PRIDEiQ8TC41
ProteomicsDBi74087

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359704; ENSP00000352734; ENSG00000146373 [Q8TC41-2]
ENST00000521654; ENSP00000428698; ENSG00000146373 [Q8TC41-1]
GeneIDi154214
KEGGihsa:154214
UCSCiuc003pzr.5 human [Q8TC41-1]

Organism-specific databases

CTDi154214
DisGeNETi154214
EuPathDBiHostDB:ENSG00000146373.16
GeneCardsiRNF217
HGNCiHGNC:21487 RNF217
HPAiHPA029598
neXtProtiNX_Q8TC41
OpenTargetsiENSG00000146373
PharmGKBiPA162401868
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1815 Eukaryota
ENOG410XP9Y LUCA
GeneTreeiENSGT00730000111285
HOVERGENiHBG096781
InParanoidiQ8TC41
KOiK11977
OrthoDBiEOG091G0R5I
TreeFamiTF330860

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRSiRNF217 human
GenomeRNAii154214
PROiPR:Q8TC41

Gene expression databases

BgeeiENSG00000146373 Expressed in 187 organ(s), highest expression level in corpus callosum
CleanExiHS_RNF217
ExpressionAtlasiQ8TC41 baseline and differential
GenevisibleiQ8TC41 HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR031127 E3_UB_ligase_RBR
IPR002867 IBR_dom
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR11685 PTHR11685, 1 hit
PfamiView protein in Pfam
PF01485 IBR, 2 hits
SMARTiView protein in SMART
SM00647 IBR, 2 hits
PROSITEiView protein in PROSITE
PS51873 TRIAD, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRN217_HUMAN
AccessioniPrimary (citable) accession number: Q8TC41
Secondary accession number(s): H7C5V4, Q5TCA4, Q9BX48
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: May 14, 2014
Last modified: November 7, 2018
This is version 128 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again