Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (17 Jun 2020)
Sequence version 2 (20 Mar 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cancer-associated gene 1 protein

Gene

CAGE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cancer-associated gene 1 protein
Short name:
CAGE-1
Alternative name(s):
Cancer/testis antigen 3
Short name:
CT3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CAGE1
Synonyms:CTAG3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164304.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21622 CAGE1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608304 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TC20

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
285782

Open Targets

More...
OpenTargetsi
ENSG00000164304

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134933951

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TC20 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CAGE1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
134035395

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002807501 – 777Cancer-associated gene 1 proteinAdd BLAST777

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TC20

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TC20

PeptideAtlas

More...
PeptideAtlasi
Q8TC20

PRoteomics IDEntifications database

More...
PRIDEi
Q8TC20

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
13991
74073 [Q8TC20-1]
74074 [Q8TC20-2]
74075 [Q8TC20-3]
74076 [Q8TC20-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TC20

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TC20

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Testis-specific expression in normal tissues, but wide expression among cancer tissues and cell lines.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164304 Expressed in testis and 21 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TC20 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TC20 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000164304 Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
130213, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TC20, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000425493

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8TC20 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TC20

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili303 – 560Sequence analysisAdd BLAST258

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001805

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_020636_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TC20

Identification of Orthologs from Complete Genome Data

More...
OMAi
SKESHCN

Database of Orthologous Groups

More...
OrthoDBi
332349at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TC20

TreeFam database of animal gene trees

More...
TreeFami
TF337775

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029381 CAGE1

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15066 CAGE1, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TC20-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNKDYQKFWS SPSDPVHFEV DTSHEKVESM SESDTMNVSN LSQGVMLSHS
60 70 80 90 100
PICMETTGTT CDLPQNEIKN FERENEYEST LCEDAYGTLD NLLNDNNIEN
110 120 130 140 150
YSTNALIQPV DTISISSLRQ FETVCKFHWV EAFDDEMTEK PEFQSQVYNY
160 170 180 190 200
AKDNNIKQDS FKEENPMETS VSANTDQLGN EYFRQPPPRS PPLIHCSGEM
210 220 230 240 250
LKFTEKSLAK SIAKESALNP SQPPSFLCKT AVPSKEIQNY GEIPEMSVSY
260 270 280 290 300
EKEVTAEGVE RPEIVSTWSS AGISWRSEAC RENCEMPDWE QSAESLQPVQ
310 320 330 340 350
EDMALNEVLQ KLKHTNRKQE VRIQELQCSN LYLEKRVKEL QMKITKQQVF
360 370 380 390 400
IDVINKLKEN VEELIEDKYK IILEKNDTKK TLQNLEEVLA NTQKHLQESR
410 420 430 440 450
NDKEMLQLQF KKIKANYVCL QERYMTEMQQ KNKSVSQYLE MDKTLSKKEE
460 470 480 490 500
EVERLQQLKK ELEKATASAL DLLKREKEAQ EQEFLSLQEE FQKLEKENLE
510 520 530 540 550
ERQKLKSRLE KLLTQVRNLQ FMSENERTKN IKLQQQINEV KNENAKLKQQ
560 570 580 590 600
VARSEEQNYV PKFETAQLKD QLEEVLKSDI TKDTKTTHSN LLPDCSPCEE
610 620 630 640 650
RLNPADIKRA SQLASKMHSL LALMVGLLTC QDIINSDAEH FKESEKVSDI
660 670 680 690 700
MLQKLKSLHL KKKTLDKEVI DCDSDEAKSI RDVPTLLGAK LDKYHSLNEE
710 720 730 740 750
LDFLVTSYEE IIECADQRLA ISHSQIAHLE ERNKHLEDLI RKPREKARKP
760 770
RSKSLENHPK SMTMMPALFK ENRNDLD
Length:777
Mass (Da):90,250
Last modified:March 20, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF69E220ADD5572EA
GO
Isoform 2 (identifier: Q8TC20-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: Missing.

Show »
Length:641
Mass (Da):74,693
Checksum:iD3F479E4294C1B0A
GO
Isoform 3 (identifier: Q8TC20-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     668-668: E → ELLKHKDRITTFRELIAKEKAFQDHAIK
     765-777: MPALFKENRNDLD → LAYNLYIFIGYRLGAVADACNPSTLGGRGGWIT

Show »
Length:824
Mass (Da):95,424
Checksum:i9AA090C11DEF4A08
GO
Isoform 4 (identifier: Q8TC20-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     669-777: VIDCDSDEAK...LFKENRNDLD → LLKHKDRITTFRELIAKEKAFQDHAIKVFQGV

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:700
Mass (Da):81,361
Checksum:iA2B72A74D31C8F44
GO
Isoform 5 (identifier: Q8TC20-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     668-668: E → ELLKHKDRITTFRELIAKEKAFQDHAIK
     704-704: L → LITKLGHLLESKENHCNRLIEENDKYQRHLGNLIKK

Show »
Length:839
Mass (Da):97,651
Checksum:i06494A9EE2297C37
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EUJ7E7EUJ7_HUMAN
Cancer-associated gene 1 protein
CAGE1
817Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCC6D6RCC6_HUMAN
Cancer-associated gene 1 protein
CAGE1
558Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9A7D6R9A7_HUMAN
Cancer-associated gene 1 protein
CAGE1
242Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti20V → A in BAC05162 (PubMed:14702039).Curated1
Sequence conflicti196C → R in BAC05162 (PubMed:14702039).Curated1
Sequence conflicti596S → P in BAC05162 (PubMed:14702039).Curated1
Sequence conflicti667K → E in BAC05162 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_031200169T → I. Corresponds to variant dbSNP:rs10223538Ensembl.1
Natural variantiVAR_031201282E → A. Corresponds to variant dbSNP:rs2876098Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0239021 – 136Missing in isoform 2. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_023969668E → ELLKHKDRITTFRELIAKEK AFQDHAIK in isoform 3 and isoform 5. 1 Publication1
Alternative sequenceiVSP_023971669 – 777VIDCD…RNDLD → LLKHKDRITTFRELIAKEKA FQDHAIKVFQGV in isoform 4. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_047149704L → LITKLGHLLESKENHCNRLI EENDKYQRHLGNLIKK in isoform 5. Curated1
Alternative sequenceiVSP_023970765 – 777MPALF…RNDLD → LAYNLYIFIGYRLGAVADAC NPSTLGGRGGWIT in isoform 3. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF414185 mRNA Translation: AAO47239.1
AK097760 mRNA Translation: BAC05162.1
AL139095 Genomic DNA No translation available.
BC026194 mRNA Translation: AAH26194.1
BC033545 mRNA Translation: AAH33545.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47367.1 [Q8TC20-2]
CCDS54964.1 [Q8TC20-3]
CCDS54965.1 [Q8TC20-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001164163.1, NM_001170692.1 [Q8TC20-5]
NP_001164164.1, NM_001170693.1 [Q8TC20-3]
NP_995586.1, NM_205864.2 [Q8TC20-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296742; ENSP00000296742; ENSG00000164304 [Q8TC20-2]
ENST00000338150; ENSP00000338107; ENSG00000164304 [Q8TC20-3]
ENST00000458291; ENSP00000390644; ENSG00000164304 [Q8TC20-4]
ENST00000502583; ENSP00000425493; ENSG00000164304 [Q8TC20-5]
ENST00000512086; ENSP00000427583; ENSG00000164304 [Q8TC20-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
285782

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:285782

UCSC genome browser

More...
UCSCi
uc063lrc.1 human [Q8TC20-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF414185 mRNA Translation: AAO47239.1
AK097760 mRNA Translation: BAC05162.1
AL139095 Genomic DNA No translation available.
BC026194 mRNA Translation: AAH26194.1
BC033545 mRNA Translation: AAH33545.1
CCDSiCCDS47367.1 [Q8TC20-2]
CCDS54964.1 [Q8TC20-3]
CCDS54965.1 [Q8TC20-5]
RefSeqiNP_001164163.1, NM_001170692.1 [Q8TC20-5]
NP_001164164.1, NM_001170693.1 [Q8TC20-3]
NP_995586.1, NM_205864.2 [Q8TC20-2]

3D structure databases

SMRiQ8TC20
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi130213, 9 interactors
IntActiQ8TC20, 12 interactors
STRINGi9606.ENSP00000425493

PTM databases

iPTMnetiQ8TC20
PhosphoSitePlusiQ8TC20

Polymorphism and mutation databases

BioMutaiCAGE1
DMDMi134035395

Proteomic databases

jPOSTiQ8TC20
MassIVEiQ8TC20
PeptideAtlasiQ8TC20
PRIDEiQ8TC20
ProteomicsDBi13991
74073 [Q8TC20-1]
74074 [Q8TC20-2]
74075 [Q8TC20-3]
74076 [Q8TC20-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24634 135 antibodies

Genome annotation databases

EnsembliENST00000296742; ENSP00000296742; ENSG00000164304 [Q8TC20-2]
ENST00000338150; ENSP00000338107; ENSG00000164304 [Q8TC20-3]
ENST00000458291; ENSP00000390644; ENSG00000164304 [Q8TC20-4]
ENST00000502583; ENSP00000425493; ENSG00000164304 [Q8TC20-5]
ENST00000512086; ENSP00000427583; ENSG00000164304 [Q8TC20-1]
GeneIDi285782
KEGGihsa:285782
UCSCiuc063lrc.1 human [Q8TC20-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
285782
DisGeNETi285782
EuPathDBiHostDB:ENSG00000164304.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CAGE1
HGNCiHGNC:21622 CAGE1
HPAiENSG00000164304 Tissue enriched (testis)
MIMi608304 gene
neXtProtiNX_Q8TC20
OpenTargetsiENSG00000164304
PharmGKBiPA134933951

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000001805
HOGENOMiCLU_020636_0_0_1
InParanoidiQ8TC20
OMAiSKESHCN
OrthoDBi332349at2759
PhylomeDBiQ8TC20
TreeFamiTF337775

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
285782 2 hits in 786 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CAGE1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
285782
PharosiQ8TC20 Tbio

Protein Ontology

More...
PROi
PR:Q8TC20
RNActiQ8TC20 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164304 Expressed in testis and 21 other tissues
ExpressionAtlasiQ8TC20 baseline and differential
GenevisibleiQ8TC20 HS

Family and domain databases

InterProiView protein in InterPro
IPR029381 CAGE1
PfamiView protein in Pfam
PF15066 CAGE1, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAGE1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TC20
Secondary accession number(s): D6RCT9
, Q5TAM0, Q86TM4, Q8N7R5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: June 17, 2020
This is version 130 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again