Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable RNA-binding protein 46

Gene

RBM46

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable RNA-binding protein 46
Alternative name(s):
Cancer/testis antigen 68
Short name:
CT68
RNA-binding motif protein 46
Gene namesi
Name:RBM46
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000151962.7
HGNCiHGNC:28401 RBM46
neXtProtiNX_Q8TBY0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000151962
PharmGKBiPA162400810

Polymorphism and mutation databases

DMDMi74760436

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003053151 – 533Probable RNA-binding protein 46Add BLAST533

Proteomic databases

EPDiQ8TBY0
MaxQBiQ8TBY0
PaxDbiQ8TBY0
PeptideAtlasiQ8TBY0
PRIDEiQ8TBY0
ProteomicsDBi74047

PTM databases

iPTMnetiQ8TBY0
PhosphoSitePlusiQ8TBY0

Expressioni

Gene expression databases

BgeeiENSG00000151962 Expressed in 44 organ(s), highest expression level in female gonad
CleanExiHS_RBM46
ExpressionAtlasiQ8TBY0 baseline and differential
GenevisibleiQ8TBY0 HS

Interactioni

Protein-protein interaction databases

BioGridi127937, 4 interactors
IntActiQ8TBY0, 3 interactors
STRINGi9606.ENSP00000281722

Structurei

3D structure databases

ProteinModelPortaliQ8TBY0
SMRiQ8TBY0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini61 – 139RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini141 – 223RRM 2PROSITE-ProRule annotationAdd BLAST83
Domaini236 – 308RRM 3PROSITE-ProRule annotationAdd BLAST73

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0117 Eukaryota
ENOG410XTJ5 LUCA
GeneTreeiENSGT00550000074366
HOGENOMiHOG000186083
HOVERGENiHBG051917
InParanoidiQ8TBY0
OMAiYNFHRSS
OrthoDBiEOG091G0EUB
PhylomeDBiQ8TBY0
TreeFamiTF314932

Family and domain databases

CDDicd12484 RRM1_RBM46, 1 hit
cd12492 RRM2_RBM46, 1 hit
Gene3Di3.30.70.330, 3 hits
InterProiView protein in InterPro
IPR006535 HnRNP_R/Q_splicing_fac
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR034434 RBM46_RRM1
IPR034435 RBM46_RRM2
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 3 hits
SMARTiView protein in SMART
SM00360 RRM, 3 hits
SUPFAMiSSF54928 SSF54928, 3 hits
TIGRFAMsiTIGR01648 hnRNP-R-Q, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 3 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TBY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNEENIDGTN GCSKVRTGIQ NEAALLALME KTGYNMVQEN GQRKFGGPPP
60 70 80 90 100
GWEGPPPPRG CEVFVGKIPR DMYEDELVPV FERAGKIYEF RLMMEFSGEN
110 120 130 140 150
RGYAFVMYTT KEEAQLAIRI LNNYEIRPGK FIGVCVSLDN CRLFIGAIPK
160 170 180 190 200
EKKKEEILDE MKKVTEGVVD VIVYPSATDK TKNRGFAFVE YESHRAAAMA
210 220 230 240 250
RRKLIPGTFQ LWGHTIQVDW ADPEKEVDEE TMQRVKVLYV RNLMISTTEE
260 270 280 290 300
TIKAEFNKFK PGAVERVKKL RDYAFVHFFN REDAVAAMSV MNGKCIDGAS
310 320 330 340 350
IEVTLAKPVN KENTWRQHLN GQISPNSENL IVFANKEESH PKTLGKLPTL
360 370 380 390 400
PARLNGQHSP SPPEVERCTY PFYPGTKLTP ISMYSLKSNH FNSAVMHLDY
410 420 430 440 450
YCNKNNWAPP EYYLYSTTSQ DGKVLLVYKI VIPAIANGSQ SYFMPDKLCT
460 470 480 490 500
TLEDAKELAA QFTLLHLDYN FHRSSINSLS PVSATLSSGT PSVLPYTSRP
510 520 530
YSYPGYPLSP TISLANGSHV GQRLCISNQA SFF
Length:533
Mass (Da):60,023
Last modified:June 1, 2002 - v1
Checksum:iA466A5AA76CD8BBE
GO
Isoform 2 (identifier: Q8TBY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     468-533: DYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQASFF → GPF

Note: No experimental confirmation available.
Show »
Length:470
Mass (Da):53,245
Checksum:i45A7F3761F83B486
GO
Isoform 3 (identifier: Q8TBY0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-533: YNFHRSSINS...LCISNQASFF → REHNLFSLDLCRRIWRK

Note: No experimental confirmation available.
Show »
Length:485
Mass (Da):55,283
Checksum:i283D315FC6E062A9
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RF41D6RF41_HUMAN
Probable RNA-binding protein 46
RBM46
133Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055251468 – 533DYNFH…QASFF → GPF in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_055252469 – 533YNFHR…QASFF → REHNLFSLDLCRRIWRK in isoform 3. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125877 mRNA Translation: BAG54260.1
AK302720 mRNA Translation: BAG63939.1
AC009567 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04902.1
CH471056 Genomic DNA Translation: EAX04903.1
BC028588 mRNA Translation: AAH28588.1
CCDSiCCDS3790.1 [Q8TBY0-1]
CCDS64085.1 [Q8TBY0-3]
CCDS64086.1 [Q8TBY0-2]
RefSeqiNP_001264100.1, NM_001277171.1 [Q8TBY0-3]
NP_001264102.1, NM_001277173.1 [Q8TBY0-2]
NP_659416.1, NM_144979.4 [Q8TBY0-1]
XP_006714182.1, XM_006714119.2 [Q8TBY0-3]
XP_006714183.1, XM_006714120.1 [Q8TBY0-2]
XP_011529994.1, XM_011531692.1 [Q8TBY0-1]
XP_011529995.1, XM_011531693.1 [Q8TBY0-1]
XP_011529996.1, XM_011531694.1 [Q8TBY0-1]
XP_011529997.1, XM_011531695.2 [Q8TBY0-1]
XP_011529998.1, XM_011531696.1 [Q8TBY0-1]
UniGeneiHs.133095
Hs.745556

Genome annotation databases

EnsembliENST00000281722; ENSP00000281722; ENSG00000151962 [Q8TBY0-1]
ENST00000510397; ENSP00000422813; ENSG00000151962 [Q8TBY0-2]
ENST00000514866; ENSP00000424500; ENSG00000151962 [Q8TBY0-3]
GeneIDi166863
KEGGihsa:166863
UCSCiuc003ioo.5 human [Q8TBY0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125877 mRNA Translation: BAG54260.1
AK302720 mRNA Translation: BAG63939.1
AC009567 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04902.1
CH471056 Genomic DNA Translation: EAX04903.1
BC028588 mRNA Translation: AAH28588.1
CCDSiCCDS3790.1 [Q8TBY0-1]
CCDS64085.1 [Q8TBY0-3]
CCDS64086.1 [Q8TBY0-2]
RefSeqiNP_001264100.1, NM_001277171.1 [Q8TBY0-3]
NP_001264102.1, NM_001277173.1 [Q8TBY0-2]
NP_659416.1, NM_144979.4 [Q8TBY0-1]
XP_006714182.1, XM_006714119.2 [Q8TBY0-3]
XP_006714183.1, XM_006714120.1 [Q8TBY0-2]
XP_011529994.1, XM_011531692.1 [Q8TBY0-1]
XP_011529995.1, XM_011531693.1 [Q8TBY0-1]
XP_011529996.1, XM_011531694.1 [Q8TBY0-1]
XP_011529997.1, XM_011531695.2 [Q8TBY0-1]
XP_011529998.1, XM_011531696.1 [Q8TBY0-1]
UniGeneiHs.133095
Hs.745556

3D structure databases

ProteinModelPortaliQ8TBY0
SMRiQ8TBY0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127937, 4 interactors
IntActiQ8TBY0, 3 interactors
STRINGi9606.ENSP00000281722

PTM databases

iPTMnetiQ8TBY0
PhosphoSitePlusiQ8TBY0

Polymorphism and mutation databases

DMDMi74760436

Proteomic databases

EPDiQ8TBY0
MaxQBiQ8TBY0
PaxDbiQ8TBY0
PeptideAtlasiQ8TBY0
PRIDEiQ8TBY0
ProteomicsDBi74047

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000281722; ENSP00000281722; ENSG00000151962 [Q8TBY0-1]
ENST00000510397; ENSP00000422813; ENSG00000151962 [Q8TBY0-2]
ENST00000514866; ENSP00000424500; ENSG00000151962 [Q8TBY0-3]
GeneIDi166863
KEGGihsa:166863
UCSCiuc003ioo.5 human [Q8TBY0-1]

Organism-specific databases

CTDi166863
EuPathDBiHostDB:ENSG00000151962.7
GeneCardsiRBM46
HGNCiHGNC:28401 RBM46
neXtProtiNX_Q8TBY0
OpenTargetsiENSG00000151962
PharmGKBiPA162400810
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0117 Eukaryota
ENOG410XTJ5 LUCA
GeneTreeiENSGT00550000074366
HOGENOMiHOG000186083
HOVERGENiHBG051917
InParanoidiQ8TBY0
OMAiYNFHRSS
OrthoDBiEOG091G0EUB
PhylomeDBiQ8TBY0
TreeFamiTF314932

Miscellaneous databases

GenomeRNAii166863
PROiPR:Q8TBY0

Gene expression databases

BgeeiENSG00000151962 Expressed in 44 organ(s), highest expression level in female gonad
CleanExiHS_RBM46
ExpressionAtlasiQ8TBY0 baseline and differential
GenevisibleiQ8TBY0 HS

Family and domain databases

CDDicd12484 RRM1_RBM46, 1 hit
cd12492 RRM2_RBM46, 1 hit
Gene3Di3.30.70.330, 3 hits
InterProiView protein in InterPro
IPR006535 HnRNP_R/Q_splicing_fac
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR034434 RBM46_RRM1
IPR034435 RBM46_RRM2
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 3 hits
SMARTiView protein in SMART
SM00360 RRM, 3 hits
SUPFAMiSSF54928 SSF54928, 3 hits
TIGRFAMsiTIGR01648 hnRNP-R-Q, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiRBM46_HUMAN
AccessioniPrimary (citable) accession number: Q8TBY0
Secondary accession number(s): B3KWU8, B4DZ27
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: June 1, 2002
Last modified: November 7, 2018
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again