Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and SCAN domain-containing protein 18

Gene

ZSCAN18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri413 – 435C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri441 – 463C2H2-type 2PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and SCAN domain-containing protein 18
Alternative name(s):
Zinc finger protein 447
Gene namesi
Name:ZSCAN18
Synonyms:ZNF447
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000121413.12
HGNCiHGNC:21037 ZSCAN18
neXtProtiNX_Q8TBC5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi65982
OpenTargetsiENSG00000121413
PharmGKBiPA162410959

Polymorphism and mutation databases

BioMutaiZSCAN18
DMDMi148887469

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002439211 – 510Zinc finger and SCAN domain-containing protein 18Add BLAST510

Proteomic databases

EPDiQ8TBC5
MaxQBiQ8TBC5
PaxDbiQ8TBC5
PeptideAtlasiQ8TBC5
PRIDEiQ8TBC5
ProteomicsDBi73993
73994 [Q8TBC5-2]
73995 [Q8TBC5-3]

PTM databases

iPTMnetiQ8TBC5
PhosphoSitePlusiQ8TBC5

Expressioni

Gene expression databases

BgeeiENSG00000121413
CleanExiHS_ZSCAN18
ExpressionAtlasiQ8TBC5 baseline and differential
GenevisibleiQ8TBC5 HS

Organism-specific databases

HPAiHPA024318

Interactioni

Protein-protein interaction databases

BioGridi122432, 15 interactors
IntActiQ8TBC5, 10 interactors
STRINGi9606.ENSP00000470123

Structurei

3D structure databases

ProteinModelPortaliQ8TBC5
SMRiQ8TBC5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini49 – 131SCAN boxPROSITE-ProRule annotationAdd BLAST83

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri413 – 435C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri441 – 463C2H2-type 2PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00910000144000
HOGENOMiHOG000069918
HOVERGENiHBG102360
InParanoidiQ8TBC5
KOiK09230
OMAiTKRPHPE
OrthoDBiEOG091G09O9
PhylomeDBiQ8TBC5

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 2 hits
SUPFAMiSSF57667 SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 2 hits
PS50157 ZINC_FINGER_C2H2_2, 2 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TBC5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLPLEKAFAS PRSSPAPPDL PTPGSAAGVQ QEEPETIPER TPADLEFSRL
60 70 80 90 100
RFREFVYQEA AGPHQTLARL HELCRQWLMP EARSKEQMLE LLVLEQFLGI
110 120 130 140 150
LPDKVRPWVV AQYPESCKKA ASLVEGLADV LEEPGMLLGS PAGSSSILSD
160 170 180 190 200
GVYERHMDPL LLPGELASPS QALGAGEIPA PSETPWLSPD PLFLEQRRVR
210 220 230 240 250
EAKTEEDGPA NTEQKLKSFP EDPQHLGEWG HLDPAEENLK SYRKLLLWGY
260 270 280 290 300
QLSQPDAASR LDTEELRLVE RDPQGSSLPE GGRRQESAGC ACEEAAPAGV
310 320 330 340 350
LPELPTEAPP GDALADPPSG TTEEEEEQPG KAPDPQDPQD AESDSATGSQ
360 370 380 390 400
RQSVIQQPAP DRGTAKLGTK RPHPEDGDGQ SLEGVSSSGD SAGLEAGQGP
410 420 430 440 450
GADEPGLSRG KPYACGECGE AFAWLSHLME HHSSHGGRKR YACQGCWKTF
460 470 480 490 500
HFSLALAEHQ KTHEKEKSYA LGGARGPQPS TREAQAGARA GGPPESVEGE
510
APPAPPEAQR
Length:510
Mass (Da):54,804
Last modified:June 12, 2007 - v2
Checksum:iCC767376B4E029FD
GO
Isoform 2 (identifier: Q8TBC5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     280-280: Missing.

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):54,675
Checksum:i8F5B7A99588DDAAA
GO
Isoform 3 (identifier: Q8TBC5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRRVGGRADEDATAAGSLWVLAPPEPTGHLVIPGTSPLEPPCPWLDSHIFQCRFGKM

Note: No experimental confirmation available.
Show »
Length:566
Mass (Da):60,825
Checksum:iE2F71AF88B3D83E5
GO
Isoform 4 (identifier: Q8TBC5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-135: Missing.
     280-280: Missing.

Note: No experimental confirmation available.
Show »
Length:374
Mass (Da):39,590
Checksum:i3CC33B737BF19B2E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti389G → S in BAB14332 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026871379G → E2 PublicationsCorresponds to variant dbSNP:rs2258557Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0470601 – 135Missing in isoform 4. CuratedAdd BLAST135
Alternative sequenceiVSP_0432721M → MRRVGGRADEDATAAGSLWV LAPPEPTGHLVIPGTSPLEP PCPWLDSHIFQCRFGKM in isoform 3. 1 Publication1
Alternative sequenceiVSP_019497280Missing in isoform 2 and isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY280799 mRNA Translation: AAQ16303.1
AK022957 mRNA Translation: BAB14332.1
AK294376 mRNA Translation: BAG57634.1
AC008751 Genomic DNA No translation available.
BC006205 mRNA Translation: AAH06205.2
BC022846 mRNA Translation: AAH22846.1
CCDSiCCDS12971.1 [Q8TBC5-1]
CCDS46214.1 [Q8TBC5-3]
CCDS46215.1 [Q8TBC5-4]
RefSeqiNP_001139014.1, NM_001145542.1 [Q8TBC5-3]
NP_001139015.1, NM_001145543.1 [Q8TBC5-1]
NP_001139016.1, NM_001145544.1 [Q8TBC5-4]
NP_076415.3, NM_023926.4 [Q8TBC5-1]
XP_005259231.1, XM_005259174.4 [Q8TBC5-1]
XP_006723398.1, XM_006723335.2 [Q8TBC5-1]
XP_011525540.1, XM_011527238.1 [Q8TBC5-1]
XP_011525541.1, XM_011527239.2 [Q8TBC5-1]
XP_016882658.1, XM_017027169.1 [Q8TBC5-2]
XP_016882659.1, XM_017027170.1 [Q8TBC5-2]
XP_016882660.1, XM_017027171.1 [Q8TBC5-2]
UniGeneiHs.235390

Genome annotation databases

EnsembliENST00000240727; ENSP00000240727; ENSG00000121413 [Q8TBC5-1]
ENST00000421612; ENSP00000392653; ENSG00000121413 [Q8TBC5-4]
ENST00000600404; ENSP00000470123; ENSG00000121413 [Q8TBC5-3]
ENST00000601144; ENSP00000468934; ENSG00000121413 [Q8TBC5-1]
GeneIDi65982
KEGGihsa:65982
UCSCiuc002qrh.3 human [Q8TBC5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZSC18_HUMAN
AccessioniPrimary (citable) accession number: Q8TBC5
Secondary accession number(s): B4DG23
, E9PBI0, Q9BRK7, Q9H9A0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 12, 2007
Last modified: July 18, 2018
This is version 142 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health