Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (17 Jun 2020)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

E3 ubiquitin-protein ligase LNX

Gene

LNX1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65.By similarity
Isoform 2 provides an endocytic scaffold for IGSF5/JAM4.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri41 – 79RING-typePROSITE-ProRule annotationAdd BLAST39

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8TBB1

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q8TBB1 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase LNX (EC:2.3.2.27)
Alternative name(s):
Ligand of Numb-protein X 1
Numb-binding protein 1
PDZ domain-containing RING finger protein 2
RING-type E3 ubiquitin transferase LNXCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LNX1
Synonyms:LNX, PDZRN2
ORF Names:UNQ574/PRO1136
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000072201.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6657 LNX1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609732 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TBB1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84708

Open Targets

More...
OpenTargetsi
ENSG00000072201

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30419

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TBB1 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LNX1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
29840786

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000559131 – 728E3 ubiquitin-protein ligase LNXAdd BLAST728

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei441PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TBB1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TBB1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TBB1

PeptideAtlas

More...
PeptideAtlasi
Q8TBB1

PRoteomics IDEntifications database

More...
PRIDEi
Q8TBB1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
73982 [Q8TBB1-1]
73983 [Q8TBB1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TBB1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TBB1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, placenta, kidney, pancreas and brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000072201 Expressed in amniotic fluid and 201 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TBB1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TBB1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000072201 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the phosphotyrosine interaction domain of all isoforms of NUMB (By similarity).

Interacts with MAGEB18 and MAGEF1.

Interacts with the Coxsackievirus and adenovirus receptor CXADR.

Interacts with endogenous retrovirus K protein Np9. IGSF5/JAM4 interacts with isoform 2 through the second PDZ domain, other isoforms may also interact with IGSF5/JAM4 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q8TBB1
With#Exp.IntAct
ABI2 - isoform 2 [Q9NYB9-2]3EBI-739832,EBI-11096309
ACAT2 [Q9BWD1]3EBI-739832,EBI-1047273
ACTN1 [P12814]3EBI-739832,EBI-351710
ACTN3 [Q08043]3EBI-739832,EBI-2880652
ACTN4 [O43707]3EBI-739832,EBI-351526
ACY3 [Q96HD9]3EBI-739832,EBI-3916242
ADAMTSL4 - isoform 3 [Q6UY14-3]3EBI-739832,EBI-10173507
AGTRAP [Q6RW13]3EBI-739832,EBI-741181
AGTRAP - isoform 2 [Q6RW13-2]3EBI-739832,EBI-11522760
AIDA [Q96BJ3]3EBI-739832,EBI-4401674
AIMP2 [Q13155]8EBI-739832,EBI-745226
ALDOC [P09972]6EBI-739832,EBI-2952751
ALKBH3 [Q96Q83]3EBI-739832,EBI-6658697
ANKS1A [Q49AR9]3EBI-739832,EBI-11954519
AP1M1 [Q9BXS5]3EBI-739832,EBI-541426
APIP [Q96GX9]11EBI-739832,EBI-359248
APOL4 [Q9BRG6]3EBI-739832,EBI-10296818
ARF3 [P61204]3EBI-739832,EBI-641535
ARFIP2 [P53365]3EBI-739832,EBI-638194
ATPAF2 [Q8N5M1]11EBI-739832,EBI-1166928
ATRIP [Q8WXE1]3EBI-739832,EBI-747353
AXIN2 [Q9Y2T1]3EBI-739832,EBI-4400025
BEND7 - isoform 2 [Q8N7W2-2]3EBI-739832,EBI-10181188
BICD2 - isoform 2 [Q8TD16-2]3EBI-739832,EBI-11975051
BIRC2 [Q13490]3EBI-739832,EBI-514538
BLVRA [P53004]5EBI-739832,EBI-7410441
BLZF1 [Q9H2G9]3EBI-739832,EBI-2548012
BORCS6 [Q96GS4]3EBI-739832,EBI-10193358
BTBD1 [Q9H0C5]3EBI-739832,EBI-935503
C1QTNF1 [Q9BXJ1]3EBI-739832,EBI-750200
C1QTNF1 - isoform 2 [Q9BXJ1-2]3EBI-739832,EBI-11536642
CA8 [P35219]6EBI-739832,EBI-718700
CABP5 [Q9NP86]3EBI-739832,EBI-10311131
CADPS [A2RRN7]3EBI-739832,EBI-10179719
CARD9 - isoform 2 [Q9H257-2]3EBI-739832,EBI-11530605
CASP6 [P55212]3EBI-739832,EBI-718729
CATSPERD [Q86XM0]3EBI-739832,EBI-10260328
CBX1 [P83916]3EBI-739832,EBI-78129
CBY1 [Q9Y3M2]3EBI-739832,EBI-947308
CBY2 - isoform 2 [Q8NA61-2]7EBI-739832,EBI-11524851
CCBE1 - isoform 3 [Q6UXH8-3]3EBI-739832,EBI-12013534
CCDC102B [Q68D86]4EBI-739832,EBI-10171570
CCDC114 [Q96M63]3EBI-739832,EBI-10173858
CCDC36 [Q8IYA8]3EBI-739832,EBI-8638439
CCDC88B [A6NC98]3EBI-739832,EBI-347573
CCDC91 - isoform 2 [Q7Z6B0-2]3EBI-739832,EBI-12012082
CCNDBP1 [O95273]3EBI-739832,EBI-748961
CDA [P32320]9EBI-739832,EBI-9250559
CDIPT [O14735]3EBI-739832,EBI-358858
CDKN2D [P55273]3EBI-739832,EBI-745859
CEP70 [Q8NHQ1]3EBI-739832,EBI-739624
CEP72 [Q9P209]6EBI-739832,EBI-739498
CEP76 [Q8TAP6]3EBI-739832,EBI-742887
CEP85 - isoform 3 [Q6P2H3-3]3EBI-739832,EBI-12368239
CIB3 [Q96Q77]3EBI-739832,EBI-10292696
CIRBP [Q14011]3EBI-739832,EBI-538850
CLK1 - isoform 3 [P49759-3]3EBI-739832,EBI-11981867
CLK2 [P49760]8EBI-739832,EBI-750020
CLK3 [P49761]3EBI-739832,EBI-745579
CMTM5 - isoform 2 [Q96DZ9-2]3EBI-739832,EBI-11522780
COIL [P38432]2EBI-739832,EBI-945751
CPNE2 [Q96FN4]3EBI-739832,EBI-7097057
CPSF7 - isoform 3 [Q8N684-3]3EBI-739832,EBI-11523759
CRACR2B - isoform 3 [Q8N4Y2-3]3EBI-739832,EBI-11982645
CRX [O43186]3EBI-739832,EBI-748171
CYSLTR2 [Q9NS75]3EBI-739832,EBI-3843579
CYSRT1 [A8MQ03]3EBI-739832,EBI-3867333
DAB1 [O75553]5EBI-739832,EBI-7875264
DCTPP1 [Q9H773]3EBI-739832,EBI-723569
DCUN1D5 [Q9BTE7]3EBI-739832,EBI-3924013
DDIT3 [P35638]3EBI-739832,EBI-742651
DDX17 [Q92841]4EBI-739832,EBI-746012
DENND1B - isoform 1 [Q6P3S1-5]3EBI-739832,EBI-12105346
DERL1 [Q9BUN8]3EBI-739832,EBI-398977
DEUP1 [Q05D60]3EBI-739832,EBI-748597
DHPS [P49366]3EBI-739832,EBI-741925
DMC1 [Q14565]3EBI-739832,EBI-930865
DNPEP [Q9ULA0]7EBI-739832,EBI-748356
DPF2 [Q92785]3EBI-739832,EBI-359932
DRAP1 [Q14919]3EBI-739832,EBI-712941
DRG1 [Q9Y295]3EBI-739832,EBI-719554
DTX2 [Q86UW9]3EBI-739832,EBI-740376
DUPD1 [Q68J44]5EBI-739832,EBI-1054321
DYDC1 [Q8WWB3]3EBI-739832,EBI-740680
DYNLT1 [P63172]3EBI-739832,EBI-1176455
EDC3 [Q96F86]3EBI-739832,EBI-997311
EEF2KMT [Q96G04]3EBI-739832,EBI-747840
EFEMP2 [O95967]3EBI-739832,EBI-743414
EFHC2 [Q5JST6]3EBI-739832,EBI-2349927
EGLN3 [Q9H6Z9]3EBI-739832,EBI-1175354
EIF1AD [Q8N9N8]3EBI-739832,EBI-750700
EIF4A3 [P38919]3EBI-739832,EBI-299104
EIF4H [Q15056]4EBI-739832,EBI-748492
ENOX1 [Q8TC92]4EBI-739832,EBI-713221
EPM2AIP1 [Q7L775]3EBI-739832,EBI-6255981
EVI5L [Q96CN4]3EBI-739832,EBI-749523
EXOSC1 [Q9Y3B2]3EBI-739832,EBI-371892
EXOSC4 [Q9NPD3]3EBI-739832,EBI-371823
EXOSC8 [Q96B26]6EBI-739832,EBI-371922
FAM118A [Q9NWS6]4EBI-739832,EBI-8638992
FAM124A [Q86V42]3EBI-739832,EBI-744506
FAM90A1 [Q86YD7]3EBI-739832,EBI-6658203
FAM9B [Q8IZU0]3EBI-739832,EBI-10175124
FASN [P49327]3EBI-739832,EBI-356658
FBXL12 [Q9NXK8]3EBI-739832,EBI-719790
FOXP2 [O15409]3EBI-739832,EBI-983612
FSD2 [A1L4K1]3EBI-739832,EBI-5661036
FXR1 - isoform 2 [P51114-2]3EBI-739832,EBI-11022345
GDI1 [P31150]6EBI-739832,EBI-946999
GLRX3 [O76003]3EBI-739832,EBI-374781
GMCL1 [Q96IK5]3EBI-739832,EBI-2548508
GMNN [O75496]3EBI-739832,EBI-371669
GOLPH3L [Q9H4A5]3EBI-739832,EBI-4403434
GPKOW [Q92917]5EBI-739832,EBI-746309
GRAP2 [O75791]4EBI-739832,EBI-740418
GRB2 [P62993]4EBI-739832,EBI-401755
GRIPAP1 [Q4V328]3EBI-739832,EBI-717919
GUCD1 - isoform 2 [Q96NT3-2]3EBI-739832,EBI-11978177
HDX [Q7Z353]3EBI-739832,EBI-1052734
HEL-S-108 [V9HW56]3EBI-739832,EBI-10330141
HEL-S-30 [V9HWB8]3EBI-739832,EBI-10215395
HEL-S-69p [V9HWF5]3EBI-739832,EBI-10330249
HEL-S-70 [V9HW80]3EBI-739832,EBI-10175326
HEXIM2 [Q96MH2]5EBI-739832,EBI-5460660
HIP1 [O00291]3EBI-739832,EBI-473886
HMBOX1 [Q6NT76]3EBI-739832,EBI-2549423
HMG20A [Q9NP66]3EBI-739832,EBI-740641
HNRNPF [P52597]3EBI-739832,EBI-352986
HNRNPH1 [P31943]3EBI-739832,EBI-351590
HOMER3 [Q9NSC5]6EBI-739832,EBI-748420
HOMEZ - isoform 2 [Q8IX15-3]3EBI-739832,EBI-10172004
HOOK2 - isoform 2 [Q96ED9-2]3EBI-739832,EBI-10961706
HOXA1 [P49639]3EBI-739832,EBI-740785
HSBP1 [O75506]10EBI-739832,EBI-748664
HSF2BP [O75031]3EBI-739832,EBI-7116203
IKZF3 [Q9UKT9]3EBI-739832,EBI-747204
IL16 - isoform 2 [Q14005-2]3EBI-739832,EBI-17178971
INO80E [Q8NBZ0]3EBI-739832,EBI-769401
INPP5K [Q9BT40]3EBI-739832,EBI-749162
IP6K3 [Q96PC2]3EBI-739832,EBI-10990676
ISCU [Q9H1K1]3EBI-739832,EBI-1047335
KATNAL2 [Q8IYT4]3EBI-739832,EBI-1044332
KCTD1 [Q719H9]7EBI-739832,EBI-9027502
KCTD13 [Q8WZ19]5EBI-739832,EBI-742916
KCTD6 [Q8NC69]4EBI-739832,EBI-2511344
KCTD7 - isoform 2 [Q96MP8-2]3EBI-739832,EBI-11954971
KCTD9 [Q7L273]6EBI-739832,EBI-4397613
KHDRBS2 [Q5VWX1]3EBI-739832,EBI-742808
KIAA1328 [Q86T90]3EBI-739832,EBI-3437878
KIF24 - isoform 2 [Q5T7B8-2]3EBI-739832,EBI-10213781
KIFC3 - isoform 4 [Q9BVG8-5]3EBI-739832,EBI-14069005
KLHL12 [Q53G59]4EBI-739832,EBI-740929
KPRP [Q5T749]3EBI-739832,EBI-10981970
KRT15 [P19012]5EBI-739832,EBI-739566
KRT16 [P08779]3EBI-739832,EBI-356410
KRTAP1-1 [Q07627]3EBI-739832,EBI-11959885
KRTAP10-8 [P60410]3EBI-739832,EBI-10171774
KRTAP12-3 [P60328]3EBI-739832,EBI-11953334
KRTAP13-3 [Q3SY46]3EBI-739832,EBI-10241252
KRTAP2-4 [Q9BYR9]3EBI-739832,EBI-14065470
KRTAP4-2 [Q9BYR5]7EBI-739832,EBI-10172511
KRTAP5-9 [P26371]3EBI-739832,EBI-3958099
KRTAP9-2 [Q9BYQ4]3EBI-739832,EBI-1044640
KRTAP9-3 [Q9BYQ3]3EBI-739832,EBI-1043191
KRTAP9-8 [Q9BYQ0]3EBI-739832,EBI-11958364
KXD1 [Q9BQD3]4EBI-739832,EBI-739657
LCLAT1 [Q6UWP7]3EBI-739832,EBI-10254507
LCP2 [Q13094]3EBI-739832,EBI-346946
LDB2 [O43679]3EBI-739832,EBI-2865580
LEPROTL1 [O95214]3EBI-739832,EBI-750776
LGALS14 [Q8TCE9]3EBI-739832,EBI-10274069
LHX2 [P50458]3EBI-739832,EBI-12179869
LONRF1 [Q17RB8]3EBI-739832,EBI-2341787
LRRC73 [Q5JTD7]3EBI-739832,EBI-12003882
LSM2 [Q9Y333]3EBI-739832,EBI-347416
LUZP4 [Q9P127]3EBI-739832,EBI-10198848
LZTS1 [Q9Y250]3EBI-739832,EBI-1216080
MAD1L1 [Q9Y6D9]3EBI-739832,EBI-742610
MAGEB18 [Q96M61]13EBI-739832,EBI-741835
MAPK9 [P45984]7EBI-739832,EBI-713568
MAPRE2 [Q15555]3EBI-739832,EBI-739717
MEMO1 [Q9Y316]6EBI-739832,EBI-1104564
MEOX2 [Q6FHY5]3EBI-739832,EBI-16439278
METTL21A [Q8WXB1]4EBI-739832,EBI-8652459
MID2 - isoform 2 [Q9UJV3-2]6EBI-739832,EBI-10172526
MLX - isoform Beta [Q9UH92-3]3EBI-739832,EBI-8852072
MRFAP1L1 [Q96HT8]7EBI-739832,EBI-748896
MRPS6 [P82932]3EBI-739832,EBI-716172
MSANTD4 [Q8NCY6]3EBI-739832,EBI-7850168
MSC [O60682]3EBI-739832,EBI-740310
MTMR9 [Q96QG7]5EBI-739832,EBI-744593
MTUS2 [Q5JR59]4EBI-739832,EBI-742948
MTUS2 - isoform 2 [Q5JR59-3]3EBI-739832,EBI-11522433
MVB12B [Q9H7P6]3EBI-739832,EBI-6149062
MYEF2 - isoform 2 [Q9P2K5-2]3EBI-739832,EBI-10318831
NAB2 [Q15742]3EBI-739832,EBI-8641936
NADK [O95544]5EBI-739832,EBI-743949
NAGK [Q9UJ70]3EBI-739832,EBI-372578
NAGK - isoform 2 [Q9UJ70-2]3EBI-739832,EBI-11526455
NCK2 [O43639]3EBI-739832,EBI-713635
NDC80 [O14777]3EBI-739832,EBI-715849
NDOR1 [Q9UHB4]3EBI-739832,EBI-10249760
NDUFAB1 [O14561]3EBI-739832,EBI-1246261
NECAB1 [Q8N987]3EBI-739832,EBI-11956853
NECAB2 - isoform 2 [Q7Z6G3-2]6EBI-739832,EBI-10172876
NEK6 [Q9HC98]3EBI-739832,EBI-740364
NME1 [P15531]3EBI-739832,EBI-741141
NME7 [Q9Y5B8]9EBI-739832,EBI-744782
NOTCH2NLA [Q7Z3S9]4EBI-739832,EBI-945833
NOTCH2NLC [P0DPK4]3EBI-739832,EBI-22310682
NUDT14 [O95848]8EBI-739832,EBI-536866
NUP62 [P37198]3EBI-739832,EBI-347978
NXT2 [Q9NPJ8]3EBI-739832,EBI-752122
ORMDL1 [Q9P0S3]3EBI-739832,EBI-1054848
OSBP2 [Q969R2]3EBI-739832,EBI-7405817
OSBP2 - isoform 2 [Q969R2-2]3EBI-739832,EBI-12211505
OSBPL3 [Q9H4L5]3EBI-739832,EBI-1051317
OSGIN1 [Q9UJX0]6EBI-739832,EBI-9057006
PAAT [Q9H8K7]5EBI-739832,EBI-714785
PAFAH1B3 [Q15102]9EBI-739832,EBI-711522
PAICS [P22234]4EBI-739832,EBI-712261
PAK5 [Q9P286]3EBI-739832,EBI-741896
PBLD [P30039]3EBI-739832,EBI-750589
PCBD1 [P61457]7EBI-739832,EBI-740475
PDE3B [Q13370]3EBI-739832,EBI-6172856
PFDN5 [Q99471]3EBI-739832,EBI-357275
PLEKHA2 [Q9HB19]5EBI-739832,EBI-4401947
PNMA1 [Q8ND90]7EBI-739832,EBI-302345
PNMA3 [Q9UL41]3EBI-739832,EBI-11278955
PNMA5 [Q96PV4]3EBI-739832,EBI-10171633
PNMT [P11086]3EBI-739832,EBI-11305767
POMGNT1 [Q8WZA1]4EBI-739832,EBI-3912424
POU6F2 [P78424]3EBI-739832,EBI-12029004
PPIA [P62937]3EBI-739832,EBI-437708
PPIH [O43447]3EBI-739832,EBI-1055615
PPP1R13B [Q96KQ4]3EBI-739832,EBI-1105153
PRDM14 [Q9GZV8]5EBI-739832,EBI-3957793
PRKAR1B [P31321]3EBI-739832,EBI-2805516
PRKRA [O75569]3EBI-739832,EBI-713955
PRMT5 [O14744]3EBI-739832,EBI-351098
PRPH [P41219]3EBI-739832,EBI-752074
PRR13 [Q9NZ81]4EBI-739832,EBI-740924
PRTFDC1 [Q9NRG1]3EBI-739832,EBI-739759
PSMC1 [P62191]3EBI-739832,EBI-357598
PSME2 [Q9UL46]3EBI-739832,EBI-741630
PSME3 [P61289]3EBI-739832,EBI-355546
PSMF1 [Q92530]3EBI-739832,EBI-945916
PTS [Q03393]3EBI-739832,EBI-712344
PURB [Q96QR8]3EBI-739832,EBI-2880222
QARS1 [P47897]3EBI-739832,EBI-347462
RAB33A [Q14088]3EBI-739832,EBI-744685
RABIF [P47224]3EBI-739832,EBI-713992
RAD51D [O75771]6EBI-739832,EBI-1055693
RAD54B [Q9Y620]4EBI-739832,EBI-740830
RALY [Q53GL6]3EBI-739832,EBI-9512693
RBAK [Q9NYW8]3EBI-739832,EBI-1210429
RBCK1 [Q9BYM8]3EBI-739832,EBI-2340624
RBM20 [Q5T481]3EBI-739832,EBI-11352885
RBMX [P38159]4EBI-739832,EBI-743526
RBMY1A1 [P0DJD3]4EBI-739832,EBI-8638511
RBMY1J [Q15415]3EBI-739832,EBI-8642021
REEP6 - isoform 2 [Q96HR9-2]3EBI-739832,EBI-14065960
RFPL3 [O75679]3EBI-739832,EBI-10188956
RGS20 - isoform 5 [O76081-6]3EBI-739832,EBI-10178530
RIOX2 [Q8IUF8]3EBI-739832,EBI-751580
ROBO3 [Q96HH0]3EBI-739832,EBI-10288358
ROPN1 [Q9HAT0]5EBI-739832,EBI-1378139
RPIA [P49247]5EBI-739832,EBI-744831
RUFY4 [Q6ZNE9]6EBI-739832,EBI-10181525
RUNDC3A - isoform 3 [Q59EK9-3]3EBI-739832,EBI-11957366
RUVBL2 [Q9Y230]6EBI-739832,EBI-352939
S100A3 [P33764]3EBI-739832,EBI-1044747
S100B [P04271]3EBI-739832,EBI-458391
SAT1 [P21673]8EBI-739832,EBI-711613
SCML1 - isoform 2 [Q9UN30-2]3EBI-739832,EBI-12137487
SCML2 [Q9UQR0]3EBI-739832,EBI-2513111
SCNM1 [Q9BWG6]3EBI-739832,EBI-748391
SEPTIN1 [Q8WYJ6]3EBI-739832,EBI-693002
SGF29 [Q96ES7]3EBI-739832,EBI-743117
SHFL - isoform 4 [Q9NUL5-4]3EBI-739832,EBI-11955083
SNRNP25 [Q9BV90]3EBI-739832,EBI-9675976
SNRPA [P09012]3EBI-739832,EBI-607085
SNRPF [P62306]3EBI-739832,EBI-356900
SP4 [Q02446]3EBI-739832,EBI-10198587
SPG21 [Q9NZD8]3EBI-739832,EBI-742688
SRC [P12931]6EBI-739832,EBI-621482
SRSF3 [P84103]3EBI-739832,EBI-372557
SSNA1 [O43805]7EBI-739832,EBI-2515299
STAC2 [Q6ZMT1]3EBI-739832,EBI-948802
SYTL2 - isoform 10 [Q9HCH5-13]3EBI-739832,EBI-14291493
TACO1 [Q9BSH4]3EBI-739832,EBI-747797
TAX1BP1 [Q86VP1]3EBI-739832,EBI-529518
TBC1D1 [Q86TI0]3EBI-739832,EBI-1644036
TBCEL [Q5QJ74]3EBI-739832,EBI-10244795
TCF12 - isoform 3 [Q99081-3]3EBI-739832,EBI-11952764
TCL1A [P56279]3EBI-739832,EBI-749995
TDO2 [P48775]3EBI-739832,EBI-743494
TEKT4 [Q8WW24]3EBI-739832,EBI-750487
TGM7 [Q96PF1]3EBI-739832,EBI-12029034
THAP1 [Q9NVV9]3EBI-739832,EBI-741515
THAP7 [Q9BT49]3EBI-739832,EBI-741350
THG1L [Q9NWX6]3EBI-739832,EBI-746510
TMEM239 - isoform 2 [Q8WW34-2]3EBI-739832,EBI-11528917
TNFAIP1 [Q13829]3EBI-739832,EBI-2505861
TNFAIP3 [P21580]3EBI-739832,EBI-527670
TRAF1 [Q13077]7EBI-739832,EBI-359224
TRAF2 [Q12933]5EBI-739832,EBI-355744
TRAF3 [Q13114]3EBI-739832,EBI-357631
TRAF4 [Q9BUZ4]3EBI-739832,EBI-3650647
TRAF5 [O00463]3EBI-739832,EBI-523498
TRAF6 [Q9Y4K3]3EBI-739832,EBI-359276
TRIM10 - isoform Beta [Q9UDY6-2]3EBI-739832,EBI-11981577
TRIM14 [Q14142]3EBI-739832,EBI-2820256
TRIM21 [P19474]3EBI-739832,EBI-81290
TRIM23 [P36406]3EBI-739832,EBI-740098
TRIM27 [P14373]3EBI-739832,EBI-719493
TRIM3 [O75382]3EBI-739832,EBI-2129889
TRIM39 [Q9HCM9]3EBI-739832,EBI-739510
TRIM39 - isoform 2 [Q9HCM9-2]3EBI-739832,EBI-11523450
TRIM42 [Q8IWZ5]3EBI-739832,EBI-5235829
TRIM50 [Q86XT4]5EBI-739832,EBI-9867283
TRIM54 [Q9BYV2]7EBI-739832,EBI-2130429
TRIM60 [Q495X7]3EBI-739832,EBI-13576620
TRIM68 [Q6AZZ1]3EBI-739832,EBI-2130449
TRIM8 [Q9BZR9]5EBI-739832,EBI-2340370
TRIP13 [Q15645]8EBI-739832,EBI-358993
TRIP6 [Q15654]3EBI-739832,EBI-742327
TRMT12 [Q53H54]3EBI-739832,EBI-10242598
TSG101 [Q99816]3EBI-739832,EBI-346882
TSN [Q15631]3EBI-739832,EBI-1044160
TSPYL2 [Q9H2G4]3EBI-739832,EBI-947459
TSSK3 [Q96PN8]7EBI-739832,EBI-3918381
UBASH3A - isoform 2 [P57075-2]3EBI-739832,EBI-7353612
UBE2D4 [Q9Y2X8]5EBI-739832,EBI-745527
UBP1 [Q9NZI7]3EBI-739832,EBI-2795133
UPP2 - isoform 2 [O95045-2]3EBI-739832,EBI-11528386
USP54 - isoform 6 [Q70EL1-9]3EBI-739832,EBI-11975223
VASN [Q6EMK4]3EBI-739832,EBI-10249550
VCP [P55072]4EBI-739832,EBI-355164
VMAC [Q2NL98]3EBI-739832,EBI-2803134
VPS37B [Q9H9H4]3EBI-739832,EBI-4400866
VPS52 [Q8N1B4]3EBI-739832,EBI-2799833
WDR25 - isoform 2 [Q64LD2-2]3EBI-739832,EBI-12032042
YWHAZ [P63104]3EBI-739832,EBI-347088
ZBED1 [O96006]3EBI-739832,EBI-740037
ZBTB2 [Q8N680]3EBI-739832,EBI-2515601
ZBTB24 [O43167]6EBI-739832,EBI-744471
ZBTB26 [Q9HCK0]3EBI-739832,EBI-3918996
ZBTB43 [O43298]5EBI-739832,EBI-740718
ZCCHC10 [Q8TBK6]3EBI-739832,EBI-597063
ZFP64 [Q9NTW7]4EBI-739832,EBI-711679
ZGPAT - isoform 2 [Q8N5A5-2]3EBI-739832,EBI-10183064
ZNF148 - isoform 2 [Q9UQR1-2]3EBI-739832,EBI-11742222
ZNF213 [O14771]3EBI-739832,EBI-12838388
ZNF263 [O14978]3EBI-739832,EBI-744493
ZNF346 [Q9UL40]3EBI-739832,EBI-2462313
ZNF426 [Q9BUY5]3EBI-739832,EBI-743265
ZNF446 - isoform 2 [Q9NWS9-2]3EBI-739832,EBI-740232
ZNF552 [Q9H707]3EBI-739832,EBI-2555731
ZNF581 [Q9P0T4]6EBI-739832,EBI-745520
ZNF593 [O00488]3EBI-739832,EBI-726769
ZNF655 [Q8N720]5EBI-739832,EBI-625509
ZRANB1 [Q9UGI0]3EBI-739832,EBI-527853

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124219, 326 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q8TBB1

Protein interaction database and analysis system

More...
IntActi
Q8TBB1, 403 interactors

Molecular INTeraction database

More...
MINTi
Q8TBB1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000263925

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8TBB1 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1728
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TBB1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8TBB1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini274 – 359PDZ 1PROSITE-ProRule annotationAdd BLAST86
Domaini381 – 464PDZ 2PROSITE-ProRule annotationAdd BLAST84
Domaini507 – 593PDZ 3PROSITE-ProRule annotationAdd BLAST87
Domaini638 – 724PDZ 4PROSITE-ProRule annotationAdd BLAST87

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni186 – 244Interaction with MAGEB181 PublicationAdd BLAST59

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi181 – 184NPXY motif4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient.
The PDZ 1 domain participates in the interaction with the PID domain of NUMB, and participates in the isoform-specific ubiquitination of NUMB. The PDZ 2 domain of isoform 2 participates in the interaction with IGSF5/JAM4, other isoforms containing this domain may also interact with IGSF5/JAM4 (By similarity).By similarity

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri41 – 79RING-typePROSITE-ProRule annotationAdd BLAST39

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3528 Eukaryota
ENOG4110362 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158757

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_021213_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TBB1

KEGG Orthology (KO)

More...
KOi
K10692

Identification of Orthologs from Complete Genome Data

More...
OMAi
PDEHGVF

Database of Orthologous Groups

More...
OrthoDBi
615205at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TBB1

TreeFam database of animal gene trees

More...
TreeFami
TF330709

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.42.10, 4 hits
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf
IPR018957 Znf_C3HC4_RING-type
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 4 hits
PF00097 zf-C3HC4, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 4 hits
SM00184 RING, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 4 hits
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TBB1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNQPESANDP EPLCAVCGQA HSLEENHFYS YPEEVDDDLI CHICLQALLD
60 70 80 90 100
PLDTPCGHTY CTLCLTNFLV EKDFCPMDRK PLVLQHCKKS SILVNKLLNK
110 120 130 140 150
LLVTCPFREH CTQVLQRCDL EHHFQTSCKG ASHYGLTKDR KRRSQDGCPD
160 170 180 190 200
GCASLTATAP SPEVSAAATI SLMTDEPGLD NPAYVSSAED GQPAISPVDS
210 220 230 240 250
GRSNRTRARP FERSTIRSRS FKKINRALSV LRRTKSGSAV ANHADQGREN
260 270 280 290 300
SENTTAPEVF PRLYHLIPDG EITSIKINRV DPSESLSIRL VGGSETPLVH
310 320 330 340 350
IIIQHIYRDG VIARDGRLLP GDIILKVNGM DISNVPHNYA VRLLRQPCQV
360 370 380 390 400
LWLTVMREQK FRSRNNGQAP DAYRPRDDSF HVILNKSSPE EQLGIKLVRK
410 420 430 440 450
VDEPGVFIFN VLDGGVAYRH GQLEENDRVL AINGHDLRYG SPESAAHLIQ
460 470 480 490 500
ASERRVHLVV SRQVRQRSPD IFQEAGWNSN GSWSPGPGER SNTPKPLHPT
510 520 530 540 550
ITCHEKVVNI QKDPGESLGM TVAGGASHRE WDLPIYVISV EPGGVISRDG
560 570 580 590 600
RIKTGDILLN VDGVELTEVS RSEAVALLKR TSSSIVLKAL EVKEYEPQED
610 620 630 640 650
CSSPAALDSN HNMAPPSDWS PSWVMWLELP RCLYNCKDIV LRRNTAGSLG
660 670 680 690 700
FCIVGGYEEY NGNKPFFIKS IVEGTPAYND GRIRCGDILL AVNGRSTSGM
710 720
IHACLARLLK ELKGRITLTI VSWPGTFL
Length:728
Mass (Da):80,629
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5590E8D8976AE093
GO
Isoform 2 (identifier: Q8TBB1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: MNQPESANDP...CDLEHHFQTS → MKALLLLVLPWLSPANYIDNVGNLHFLYSEL

Show »
Length:632
Mass (Da):69,643
Checksum:i1B343BEF469CB005
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RB76D6RB76_HUMAN
E3 ubiquitin-protein ligase LNX
LNX1
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAH9D6RAH9_HUMAN
E3 ubiquitin-protein ligase LNX
LNX1
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J209A0A0B4J209_HUMAN
E3 ubiquitin-protein ligase LNX
LNX1
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RE08D6RE08_HUMAN
E3 ubiquitin-protein ligase LNX
LNX1
16Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti132S → F in AAK15039 (PubMed:11521506).Curated1
Sequence conflicti321G → R in BAB71291 (PubMed:14702039).Curated1
Sequence conflicti366N → T in BAB71291 (PubMed:14702039).Curated1
Sequence conflicti411V → A in BAB71291 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0057331 – 127MNQPE…HFQTS → MKALLLLVLPWLSPANYIDN VGNLHFLYSEL in isoform 2. 3 PublicationsAdd BLAST127

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF237782 mRNA Translation: AAK15039.1
AY358326 mRNA Translation: AAQ88692.1
AK056823 mRNA Translation: BAB71291.1
AC058822 Genomic DNA No translation available.
AC095040 Genomic DNA Translation: AAY41000.1
BC022983 mRNA Translation: AAH22983.1
BC034737 mRNA Translation: AAH34737.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3492.1 [Q8TBB1-2]
CCDS47057.1 [Q8TBB1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001119800.1, NM_001126328.2 [Q8TBB1-1]
NP_116011.2, NM_032622.2 [Q8TBB1-2]
XP_005265842.1, XM_005265785.4 [Q8TBB1-1]
XP_016864265.1, XM_017008776.1 [Q8TBB1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263925; ENSP00000263925; ENSG00000072201 [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201 [Q8TBB1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84708

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84708

UCSC genome browser

More...
UCSCi
uc003haf.5 human [Q8TBB1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237782 mRNA Translation: AAK15039.1
AY358326 mRNA Translation: AAQ88692.1
AK056823 mRNA Translation: BAB71291.1
AC058822 Genomic DNA No translation available.
AC095040 Genomic DNA Translation: AAY41000.1
BC022983 mRNA Translation: AAH22983.1
BC034737 mRNA Translation: AAH34737.1
CCDSiCCDS3492.1 [Q8TBB1-2]
CCDS47057.1 [Q8TBB1-1]
RefSeqiNP_001119800.1, NM_001126328.2 [Q8TBB1-1]
NP_116011.2, NM_032622.2 [Q8TBB1-2]
XP_005265842.1, XM_005265785.4 [Q8TBB1-1]
XP_016864265.1, XM_017008776.1 [Q8TBB1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3B76X-ray1.75A/B504-594[»]
5H7RX-ray1.70D11-138[»]
5H7SX-ray3.49B/D11-138[»]
SMRiQ8TBB1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi124219, 326 interactors
ELMiQ8TBB1
IntActiQ8TBB1, 403 interactors
MINTiQ8TBB1
STRINGi9606.ENSP00000263925

Protein family/group databases

MoonDBiQ8TBB1 Predicted

PTM databases

iPTMnetiQ8TBB1
PhosphoSitePlusiQ8TBB1

Polymorphism and mutation databases

BioMutaiLNX1
DMDMi29840786

Proteomic databases

jPOSTiQ8TBB1
MassIVEiQ8TBB1
PaxDbiQ8TBB1
PeptideAtlasiQ8TBB1
PRIDEiQ8TBB1
ProteomicsDBi73982 [Q8TBB1-1]
73983 [Q8TBB1-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1114 222 antibodies

The DNASU plasmid repository

More...
DNASUi
84708

Genome annotation databases

EnsembliENST00000263925; ENSP00000263925; ENSG00000072201 [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201 [Q8TBB1-2]
GeneIDi84708
KEGGihsa:84708
UCSCiuc003haf.5 human [Q8TBB1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84708
DisGeNETi84708
EuPathDBiHostDB:ENSG00000072201.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LNX1
HGNCiHGNC:6657 LNX1
HPAiENSG00000072201 Low tissue specificity
MIMi609732 gene
neXtProtiNX_Q8TBB1
OpenTargetsiENSG00000072201
PharmGKBiPA30419

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3528 Eukaryota
ENOG4110362 LUCA
GeneTreeiENSGT00940000158757
HOGENOMiCLU_021213_0_0_1
InParanoidiQ8TBB1
KOiK10692
OMAiPDEHGVF
OrthoDBi615205at2759
PhylomeDBiQ8TBB1
TreeFamiTF330709

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ8TBB1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84708 0 hits in 786 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LNX1 human
EvolutionaryTraceiQ8TBB1

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LNX1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84708
PharosiQ8TBB1 Tbio

Protein Ontology

More...
PROi
PR:Q8TBB1
RNActiQ8TBB1 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000072201 Expressed in amniotic fluid and 201 other tissues
ExpressionAtlasiQ8TBB1 baseline and differential
GenevisibleiQ8TBB1 HS

Family and domain databases

Gene3Di2.30.42.10, 4 hits
3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf
IPR018957 Znf_C3HC4_RING-type
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PfamiView protein in Pfam
PF00595 PDZ, 4 hits
PF00097 zf-C3HC4, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 4 hits
SM00184 RING, 1 hit
SUPFAMiSSF50156 SSF50156, 4 hits
PROSITEiView protein in PROSITE
PS50106 PDZ, 4 hits
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLNX1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TBB1
Secondary accession number(s): Q4W5K7
, Q8N4C2, Q96MJ7, Q9BY20
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: June 1, 2002
Last modified: June 17, 2020
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again