Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase LNX

Gene

LNX1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65.By similarity
Isoform 2 provides an endocytic scaffold for IGSF5/JAM4.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri41 – 79RING-typePROSITE-ProRule annotationAdd BLAST39

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8TBB1

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q8TBB1 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase LNX (EC:2.3.2.27)
Alternative name(s):
Ligand of Numb-protein X 1
Numb-binding protein 1
PDZ domain-containing RING finger protein 2
RING-type E3 ubiquitin transferase LNXCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LNX1
Synonyms:LNX, PDZRN2
ORF Names:UNQ574/PRO1136
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000072201.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6657 LNX1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609732 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TBB1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84708

Open Targets

More...
OpenTargetsi
ENSG00000072201

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30419

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LNX1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
29840786

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000559131 – 728E3 ubiquitin-protein ligase LNXAdd BLAST728

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei441PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TBB1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TBB1

PeptideAtlas

More...
PeptideAtlasi
Q8TBB1

PRoteomics IDEntifications database

More...
PRIDEi
Q8TBB1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
73982
73983 [Q8TBB1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TBB1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TBB1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, placenta, kidney, pancreas and brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000072201 Expressed in 202 organ(s), highest expression level in amniotic fluid

CleanEx database of gene expression profiles

More...
CleanExi
HS_LNX1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TBB1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TBB1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA002235
HPA071091

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the phosphotyrosine interaction domain of all isoforms of NUMB (By similarity). Interacts with MAGEB18 and MAGEF1. Interacts with the Coxsackievirus and adenovirus receptor CXADR. Interacts with endogenous retrovirus K protein Np9. IGSF5/JAM4 interacts with isoform 2 through the second PDZ domain, other isoforms may also interact with IGSF5/JAM4 (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ACAT2Q9BWD13EBI-739832,EBI-1047273
ACY3Q96HD93EBI-739832,EBI-3916242
AGTRAPQ6RW133EBI-739832,EBI-741181
AIDAQ96BJ33EBI-739832,EBI-4401674
AIMP2Q131556EBI-739832,EBI-745226
ALDOCP099725EBI-739832,EBI-2952751
ALKBH3Q96Q833EBI-739832,EBI-6658697
APIPQ96GX98EBI-739832,EBI-359248
APOL4Q9BRG63EBI-739832,EBI-10296818
ATPAF2Q8N5M18EBI-739832,EBI-1166928
ATRIPQ8WXE13EBI-739832,EBI-747353
BLVRAP530043EBI-739832,EBI-7410441
C1QTNF1Q9BXJ13EBI-739832,EBI-750200
CA8P352196EBI-739832,EBI-718700
CATSPERDQ86XM03EBI-739832,EBI-10260328
CCDC102BQ68D863EBI-739832,EBI-10171570
CCDC114Q96M633EBI-739832,EBI-10173858
CDAP323208EBI-739832,EBI-9250559
CEP72Q9P2093EBI-739832,EBI-739498
CIB3Q96Q773EBI-739832,EBI-10292696
CIRBPQ140113EBI-739832,EBI-538850
CLK2P497607EBI-739832,EBI-750020
COILP384322EBI-739832,EBI-945751
CPNE2Q96FN43EBI-739832,EBI-7097057
DAB1O755533EBI-739832,EBI-7875264
DCTDP323213EBI-739832,EBI-739870
DCUN1D5Q9BTE73EBI-739832,EBI-3924013
DDX17Q928413EBI-739832,EBI-746012
DNPEPQ9ULA05EBI-739832,EBI-748356
DPF2Q927853EBI-739832,EBI-359932
EIF4HQ150563EBI-739832,EBI-748492
ENOX1Q8TC923EBI-739832,EBI-713221
EXOSC8Q96B264EBI-739832,EBI-371922
FAM118AQ9NWS63EBI-739832,EBI-8638992
FAM124AQ86V423EBI-739832,EBI-744506
FAM9BQ8IZU03EBI-739832,EBI-10175124
FBXL12Q9NXK83EBI-739832,EBI-719790
GDI1P311506EBI-739832,EBI-946999
GOLPH3LQ9H4A53EBI-739832,EBI-4403434
GRAP2O757914EBI-739832,EBI-740418
GRB2P629933EBI-739832,EBI-401755
HEL-S-108V9HW563EBI-739832,EBI-10330141
HEL-S-30V9HWB83EBI-739832,EBI-10215395
HEL-S-69pV9HWF53EBI-739832,EBI-10330249
HEL-S-70V9HW803EBI-739832,EBI-10175326
HMBOX1Q6NT763EBI-739832,EBI-2549423
HOMER3Q9NSC54EBI-739832,EBI-748420
HOMEZQ8IX15-33EBI-739832,EBI-10172004
HSBP1O755067EBI-739832,EBI-748664
INPP5KQ9BT403EBI-739832,EBI-749162
ISCUQ9H1K13EBI-739832,EBI-1047335
KCTD1Q719H95EBI-739832,EBI-9027502
KCTD13Q8WZ193EBI-739832,EBI-742916
KCTD6Q8NC693EBI-739832,EBI-2511344
KCTD9Q7L2734EBI-739832,EBI-4397613
KIFC3Q9BVG8-54EBI-739832,EBI-14069005
KLHL12Q53G593EBI-739832,EBI-740929
KRT15P190123EBI-739832,EBI-739566
KRTAP4-2Q9BYR55EBI-739832,EBI-10172511
KRTAP9-2Q9BYQ43EBI-739832,EBI-1044640
KXD1Q9BQD33EBI-739832,EBI-739657
LCLAT1Q6UWP73EBI-739832,EBI-10254507
LGALS14Q8TCE93EBI-739832,EBI-10274069
LSM2Q9Y3333EBI-739832,EBI-347416
MAGEB18Q96M6111EBI-739832,EBI-741835
MAPK9P459845EBI-739832,EBI-713568
MEMO1Q9Y3165EBI-739832,EBI-1104564
METTL21AQ8WXB13EBI-739832,EBI-8652459
MID2Q9UJV3-24EBI-739832,EBI-10172526
MRFAP1L1Q96HT85EBI-739832,EBI-748896
MTMR9Q96QG73EBI-739832,EBI-744593
MTUS2Q5JR593EBI-739832,EBI-742948
MVB12BQ9H7P63EBI-739832,EBI-6149062
NADKO955443EBI-739832,EBI-743949
NAGKQ9UJ702EBI-739832,EBI-372578
NCK2O436393EBI-739832,EBI-713635
NECAB2Q7Z6G3-25EBI-739832,EBI-10172876
NEK6Q9HC983EBI-739832,EBI-740364
NME7Q9Y5B85EBI-739832,EBI-744782
NOTCH2NLAQ7Z3S95EBI-739832,EBI-945833
NUDT14O958487EBI-739832,EBI-536866
NXT2Q9NPJ83EBI-739832,EBI-752122
OSBP2Q969R23EBI-739832,EBI-7405817
OSGIN1Q9UJX03EBI-739832,EBI-9057006
PAFAH1B3Q151026EBI-739832,EBI-711522
PAICSP222343EBI-739832,EBI-712261
PBLDP300393EBI-739832,EBI-750589
PCBD1P614576EBI-739832,EBI-740475
PNMA1Q8ND906EBI-739832,EBI-302345
PNMA5Q96PV44EBI-739832,EBI-10171633
POMGNT1Q8WZA13EBI-739832,EBI-3912424
PPIAP629373EBI-739832,EBI-437708
PRR13Q9NZ814EBI-739832,EBI-740924
PTSQ033933EBI-739832,EBI-712344
RAD51DO757716EBI-739832,EBI-1055693
RAD54BQ9Y6203EBI-739832,EBI-740830
RBMXP381593EBI-739832,EBI-743526
RBMY1A1P0DJD33EBI-739832,EBI-8638511
RFPL3O756793EBI-739832,EBI-10188956
ROBO3Q96HH03EBI-739832,EBI-10288358
ROPN1Q9HAT03EBI-739832,EBI-1378139
RPIAP492473EBI-739832,EBI-744831
RUFY4Q6ZNE95EBI-739832,EBI-10181525
RUVBL2Q9Y2305EBI-739832,EBI-352939
SAT1P216738EBI-739832,EBI-711613
SGF29Q96ES73EBI-739832,EBI-743117
SNRNP25Q9BV903EBI-739832,EBI-9675976
SNRPFP623063EBI-739832,EBI-356900
SPERTQ8NA61-26EBI-739832,EBI-11524851
SRCP129316EBI-739832,EBI-621482
SSNA1O438055EBI-739832,EBI-2515299
STAC2Q6ZMT13EBI-739832,EBI-948802
TBCELQ5QJ743EBI-739832,EBI-10244795
THAP7Q9BT493EBI-739832,EBI-741350
TIFAQ96CG33EBI-739832,EBI-740711
TRAF1Q130776EBI-739832,EBI-359224
TRAF2Q129333EBI-739832,EBI-355744
TRIM39Q9HCM93EBI-739832,EBI-739510
TRIM54Q9BYV25EBI-739832,EBI-2130429
TRIP13Q156456EBI-739832,EBI-358993
TRMT12Q53H543EBI-739832,EBI-10242598
TSSK3Q96PN85EBI-739832,EBI-3918381
ZBTB24O431674EBI-739832,EBI-744471
ZBTB43O432983EBI-739832,EBI-740718
ZCCHC10Q8TBK63EBI-739832,EBI-597063
ZFP64Q9NTW73EBI-739832,EBI-745730
ZNF581Q9P0T45EBI-739832,EBI-745520
ZNF593O004883EBI-739832,EBI-726769

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124219, 317 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q8TBB1

Protein interaction database and analysis system

More...
IntActi
Q8TBB1, 410 interactors

Molecular INTeraction database

More...
MINTi
Q8TBB1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000263925

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1728
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3B76X-ray1.75A/B504-594[»]
5H7RX-ray1.70D11-138[»]
5H7SX-ray3.49B/D11-138[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8TBB1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TBB1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8TBB1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini274 – 359PDZ 1PROSITE-ProRule annotationAdd BLAST86
Domaini381 – 464PDZ 2PROSITE-ProRule annotationAdd BLAST84
Domaini507 – 593PDZ 3PROSITE-ProRule annotationAdd BLAST87
Domaini638 – 724PDZ 4PROSITE-ProRule annotationAdd BLAST87

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni186 – 244Interaction with MAGEB181 PublicationAdd BLAST59

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi181 – 184NPXY motif4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient.
The PDZ 1 domain participates in the interaction with the PID domain of NUMB, and participates in the isoform-specific ubiquitination of NUMB. The PDZ 2 domain of isoform 2 participates in the interaction with IGSF5/JAM4, other isoforms containing this domain may also interact with IGSF5/JAM4 (By similarity).By similarity

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri41 – 79RING-typePROSITE-ProRule annotationAdd BLAST39

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3528 Eukaryota
ENOG4110362 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158757

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000261605

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG039539

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TBB1

KEGG Orthology (KO)

More...
KOi
K10692

Identification of Orthologs from Complete Genome Data

More...
OMAi
PGDMILK

Database of Orthologous Groups

More...
OrthoDBi
615205at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TBB1

TreeFam database of animal gene trees

More...
TreeFami
TF330709

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf
IPR018957 Znf_C3HC4_RING-type
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 4 hits
PF00097 zf-C3HC4, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 4 hits
SM00184 RING, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 4 hits
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TBB1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNQPESANDP EPLCAVCGQA HSLEENHFYS YPEEVDDDLI CHICLQALLD
60 70 80 90 100
PLDTPCGHTY CTLCLTNFLV EKDFCPMDRK PLVLQHCKKS SILVNKLLNK
110 120 130 140 150
LLVTCPFREH CTQVLQRCDL EHHFQTSCKG ASHYGLTKDR KRRSQDGCPD
160 170 180 190 200
GCASLTATAP SPEVSAAATI SLMTDEPGLD NPAYVSSAED GQPAISPVDS
210 220 230 240 250
GRSNRTRARP FERSTIRSRS FKKINRALSV LRRTKSGSAV ANHADQGREN
260 270 280 290 300
SENTTAPEVF PRLYHLIPDG EITSIKINRV DPSESLSIRL VGGSETPLVH
310 320 330 340 350
IIIQHIYRDG VIARDGRLLP GDIILKVNGM DISNVPHNYA VRLLRQPCQV
360 370 380 390 400
LWLTVMREQK FRSRNNGQAP DAYRPRDDSF HVILNKSSPE EQLGIKLVRK
410 420 430 440 450
VDEPGVFIFN VLDGGVAYRH GQLEENDRVL AINGHDLRYG SPESAAHLIQ
460 470 480 490 500
ASERRVHLVV SRQVRQRSPD IFQEAGWNSN GSWSPGPGER SNTPKPLHPT
510 520 530 540 550
ITCHEKVVNI QKDPGESLGM TVAGGASHRE WDLPIYVISV EPGGVISRDG
560 570 580 590 600
RIKTGDILLN VDGVELTEVS RSEAVALLKR TSSSIVLKAL EVKEYEPQED
610 620 630 640 650
CSSPAALDSN HNMAPPSDWS PSWVMWLELP RCLYNCKDIV LRRNTAGSLG
660 670 680 690 700
FCIVGGYEEY NGNKPFFIKS IVEGTPAYND GRIRCGDILL AVNGRSTSGM
710 720
IHACLARLLK ELKGRITLTI VSWPGTFL
Length:728
Mass (Da):80,629
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5590E8D8976AE093
GO
Isoform 2 (identifier: Q8TBB1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: MNQPESANDP...CDLEHHFQTS → MKALLLLVLPWLSPANYIDNVGNLHFLYSEL

Show »
Length:632
Mass (Da):69,643
Checksum:i1B343BEF469CB005
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RAH9D6RAH9_HUMAN
E3 ubiquitin-protein ligase LNX
LNX1
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RB76D6RB76_HUMAN
E3 ubiquitin-protein ligase LNX
LNX1
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J209A0A0B4J209_HUMAN
E3 ubiquitin-protein ligase LNX
LNX1
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RE08D6RE08_HUMAN
E3 ubiquitin-protein ligase LNX
LNX1
16Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti132S → F in AAK15039 (PubMed:11521506).Curated1
Sequence conflicti321G → R in BAB71291 (PubMed:14702039).Curated1
Sequence conflicti366N → T in BAB71291 (PubMed:14702039).Curated1
Sequence conflicti411V → A in BAB71291 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0057331 – 127MNQPE…HFQTS → MKALLLLVLPWLSPANYIDN VGNLHFLYSEL in isoform 2. 3 PublicationsAdd BLAST127

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF237782 mRNA Translation: AAK15039.1
AY358326 mRNA Translation: AAQ88692.1
AK056823 mRNA Translation: BAB71291.1
AC058822 Genomic DNA No translation available.
AC095040 Genomic DNA Translation: AAY41000.1
BC022983 mRNA Translation: AAH22983.1
BC034737 mRNA Translation: AAH34737.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3492.1 [Q8TBB1-2]
CCDS47057.1 [Q8TBB1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001119800.1, NM_001126328.2 [Q8TBB1-1]
NP_116011.2, NM_032622.2 [Q8TBB1-2]
XP_005265842.1, XM_005265785.4 [Q8TBB1-1]
XP_016864265.1, XM_017008776.1 [Q8TBB1-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.518760

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263925; ENSP00000263925; ENSG00000072201 [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201 [Q8TBB1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84708

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84708

UCSC genome browser

More...
UCSCi
uc003haf.5 human [Q8TBB1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237782 mRNA Translation: AAK15039.1
AY358326 mRNA Translation: AAQ88692.1
AK056823 mRNA Translation: BAB71291.1
AC058822 Genomic DNA No translation available.
AC095040 Genomic DNA Translation: AAY41000.1
BC022983 mRNA Translation: AAH22983.1
BC034737 mRNA Translation: AAH34737.1
CCDSiCCDS3492.1 [Q8TBB1-2]
CCDS47057.1 [Q8TBB1-1]
RefSeqiNP_001119800.1, NM_001126328.2 [Q8TBB1-1]
NP_116011.2, NM_032622.2 [Q8TBB1-2]
XP_005265842.1, XM_005265785.4 [Q8TBB1-1]
XP_016864265.1, XM_017008776.1 [Q8TBB1-1]
UniGeneiHs.518760

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3B76X-ray1.75A/B504-594[»]
5H7RX-ray1.70D11-138[»]
5H7SX-ray3.49B/D11-138[»]
ProteinModelPortaliQ8TBB1
SMRiQ8TBB1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124219, 317 interactors
ELMiQ8TBB1
IntActiQ8TBB1, 410 interactors
MINTiQ8TBB1
STRINGi9606.ENSP00000263925

Protein family/group databases

MoonDBiQ8TBB1 Predicted

PTM databases

iPTMnetiQ8TBB1
PhosphoSitePlusiQ8TBB1

Polymorphism and mutation databases

BioMutaiLNX1
DMDMi29840786

Proteomic databases

jPOSTiQ8TBB1
PaxDbiQ8TBB1
PeptideAtlasiQ8TBB1
PRIDEiQ8TBB1
ProteomicsDBi73982
73983 [Q8TBB1-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84708
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263925; ENSP00000263925; ENSG00000072201 [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201 [Q8TBB1-2]
GeneIDi84708
KEGGihsa:84708
UCSCiuc003haf.5 human [Q8TBB1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84708
DisGeNETi84708
EuPathDBiHostDB:ENSG00000072201.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LNX1
HGNCiHGNC:6657 LNX1
HPAiHPA002235
HPA071091
MIMi609732 gene
neXtProtiNX_Q8TBB1
OpenTargetsiENSG00000072201
PharmGKBiPA30419

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3528 Eukaryota
ENOG4110362 LUCA
GeneTreeiENSGT00940000158757
HOGENOMiHOG000261605
HOVERGENiHBG039539
InParanoidiQ8TBB1
KOiK10692
OMAiPGDMILK
OrthoDBi615205at2759
PhylomeDBiQ8TBB1
TreeFamiTF330709

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ8TBB1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LNX1 human
EvolutionaryTraceiQ8TBB1

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LNX1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84708

Protein Ontology

More...
PROi
PR:Q8TBB1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000072201 Expressed in 202 organ(s), highest expression level in amniotic fluid
CleanExiHS_LNX1
ExpressionAtlasiQ8TBB1 baseline and differential
GenevisibleiQ8TBB1 HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf
IPR018957 Znf_C3HC4_RING-type
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PfamiView protein in Pfam
PF00595 PDZ, 4 hits
PF00097 zf-C3HC4, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 4 hits
SM00184 RING, 1 hit
SUPFAMiSSF50156 SSF50156, 4 hits
PROSITEiView protein in PROSITE
PS50106 PDZ, 4 hits
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLNX1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TBB1
Secondary accession number(s): Q4W5K7
, Q8N4C2, Q96MJ7, Q9BY20
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: June 1, 2002
Last modified: January 16, 2019
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again