Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (03 Jul 2019)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

LIM domain only protein 3

Gene

LMO3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8TAP4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM domain only protein 3
Short name:
LMO-3
Alternative name(s):
Neuronal-specific transcription factor DAT1
Rhombotin-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LMO3
Synonyms:RBTN3, RBTNL2, RHOM3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6643 LMO3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
180386 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TAP4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55885

Open Targets

More...
OpenTargetsi
ENSG00000048540

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30409

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LMO3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
34098603

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758171 – 145LIM domain only protein 3Add BLAST145

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TAP4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TAP4

PRoteomics IDEntifications database

More...
PRIDEi
Q8TAP4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
73900

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TAP4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TAP4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000048540 Expressed in 186 organ(s), highest expression level in caudate nucleus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TAP4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TAP4 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120977, 39 interactors

Database of interacting proteins

More...
DIPi
DIP-50129N

Protein interaction database and analysis system

More...
IntActi
Q8TAP4, 114 interactors

Molecular INTeraction database

More...
MINTi
Q8TAP4

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TAP4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini11 – 73LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST63
Domaini75 – 137LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST63

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0490 Eukaryota
ENOG410YIJ3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153908

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232175

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TAP4

Identification of Orthologs from Complete Genome Data

More...
OMAi
XLFGVTG

Database of Orthologous Groups

More...
OrthoDBi
1307952at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TAP4

TreeFam database of animal gene trees

More...
TreeFami
TF351071

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001781 Znf_LIM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00412 LIM, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132 LIM, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TAP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSVQPDTKP KGCAGCNRKI KDRYLLKALD KYWHEDCLKC ACCDCRLGEV
60 70 80 90 100
GSTLYTKANL ILCRRDYLRL FGVTGNCAAC SKLIPAFEMV MRAKDNVYHL
110 120 130 140
DCFACQLCNQ RFCVGDKFFL KNNMILCQTD YEEGLMKEGY APQVR
Length:145
Mass (Da):16,594
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i05284546BA5EC226
GO
Isoform 2 (identifier: Q8TAP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-69: VGSTLYTKANLILCRRDYLR → HLKRCGSIYIHAAHTEIGICVTLEWPLPFVIIDFSQQITIAW

Show »
Length:167
Mass (Da):19,059
Checksum:i15DF48CDCE2DB95F
GO
Isoform 3 (identifier: Q8TAP4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQKKEKSFGIQM

Show »
Length:156
Mass (Da):17,899
Checksum:i57C8202A34AF191D
GO
Isoform 4 (identifier: Q8TAP4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLMEGGRAAAARNVSSIQM

Show »
Length:163
Mass (Da):18,438
Checksum:i63D462FD89CCBE05
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JE61C9JE61_HUMAN
LIM domain only protein 3
LMO3
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H2N9F5H2N9_HUMAN
LIM domain only protein 3
LMO3
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GYZ6F5GYZ6_HUMAN
LIM domain only protein 3
LMO3
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4K9F5H4K9_HUMAN
LIM domain only protein 3
LMO3
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4T0F5H4T0_HUMAN
LIM domain only protein 3
LMO3
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GZR3F5GZR3_HUMAN
LIM domain only protein 3
LMO3
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H655F5H655_HUMAN
LIM domain only protein 3
LMO3
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3S4F5H3S4_HUMAN
LIM domain only protein 3
LMO3
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6TDU8F6TDU8_HUMAN
LIM domain only protein 3
LMO3
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q05D86Q05D86_HUMAN
LIM domain only protein 3
LMO3
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29L → P in BAC04582 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0453121M → MQKKEKSFGIQM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0473791M → MLMEGGRAAAARNVSSIQM in isoform 4. 1 Publication1
Alternative sequenceiVSP_04531350 – 69VGSTL…RDYLR → HLKRCGSIYIHAAHTEIGIC VTLEWPLPFVIIDFSQQITI AW in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB044745 mRNA Translation: BAD93349.1
AB044746 mRNA Translation: BAD93350.1
AK095595 mRNA Translation: BAC04582.1
AK294474 mRNA Translation: BAG57701.1
AK294909 mRNA Translation: BAG57996.1
AK316021 mRNA Translation: BAH14392.1
AC007529 Genomic DNA No translation available.
AC007552 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96371.1
BC026311 mRNA Translation: AAH26311.1
BC050085 mRNA Translation: AAH50085.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58210.1 [Q8TAP4-2]
CCDS58211.1 [Q8TAP4-3]
CCDS58212.1 [Q8TAP4-4]
CCDS8678.1 [Q8TAP4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001001395.1, NM_001001395.2 [Q8TAP4-1]
NP_001230538.1, NM_001243609.1 [Q8TAP4-1]
NP_001230539.1, NM_001243610.1 [Q8TAP4-1]
NP_001230540.1, NM_001243611.1 [Q8TAP4-3]
NP_001230541.1, NM_001243612.1 [Q8TAP4-4]
NP_001230542.1, NM_001243613.1 [Q8TAP4-2]
NP_061110.2, NM_018640.4 [Q8TAP4-1]
XP_006719173.1, XM_006719110.3 [Q8TAP4-1]
XP_006719174.1, XM_006719111.2 [Q8TAP4-1]
XP_011519064.1, XM_011520762.1 [Q8TAP4-1]
XP_011519065.1, XM_011520763.1 [Q8TAP4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261169; ENSP00000261169; ENSG00000048540 [Q8TAP4-3]
ENST00000320122; ENSP00000312856; ENSG00000048540 [Q8TAP4-1]
ENST00000354662; ENSP00000346689; ENSG00000048540 [Q8TAP4-1]
ENST00000441439; ENSP00000412479; ENSG00000048540 [Q8TAP4-1]
ENST00000447609; ENSP00000413703; ENSG00000048540 [Q8TAP4-1]
ENST00000534946; ENSP00000439275; ENSG00000048540 [Q8TAP4-1]
ENST00000535535; ENSP00000446115; ENSG00000048540 [Q8TAP4-1]
ENST00000537304; ENSP00000440099; ENSG00000048540 [Q8TAP4-1]
ENST00000540445; ENSP00000442786; ENSG00000048540 [Q8TAP4-2]
ENST00000540848; ENSP00000445751; ENSG00000048540 [Q8TAP4-1]
ENST00000541295; ENSP00000446463; ENSG00000048540 [Q8TAP4-4]
ENST00000541846; ENSP00000444393; ENSG00000048540 [Q8TAP4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55885

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55885

UCSC genome browser

More...
UCSCi
uc001rdj.3 human [Q8TAP4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044745 mRNA Translation: BAD93349.1
AB044746 mRNA Translation: BAD93350.1
AK095595 mRNA Translation: BAC04582.1
AK294474 mRNA Translation: BAG57701.1
AK294909 mRNA Translation: BAG57996.1
AK316021 mRNA Translation: BAH14392.1
AC007529 Genomic DNA No translation available.
AC007552 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96371.1
BC026311 mRNA Translation: AAH26311.1
BC050085 mRNA Translation: AAH50085.1
CCDSiCCDS58210.1 [Q8TAP4-2]
CCDS58211.1 [Q8TAP4-3]
CCDS58212.1 [Q8TAP4-4]
CCDS8678.1 [Q8TAP4-1]
RefSeqiNP_001001395.1, NM_001001395.2 [Q8TAP4-1]
NP_001230538.1, NM_001243609.1 [Q8TAP4-1]
NP_001230539.1, NM_001243610.1 [Q8TAP4-1]
NP_001230540.1, NM_001243611.1 [Q8TAP4-3]
NP_001230541.1, NM_001243612.1 [Q8TAP4-4]
NP_001230542.1, NM_001243613.1 [Q8TAP4-2]
NP_061110.2, NM_018640.4 [Q8TAP4-1]
XP_006719173.1, XM_006719110.3 [Q8TAP4-1]
XP_006719174.1, XM_006719111.2 [Q8TAP4-1]
XP_011519064.1, XM_011520762.1 [Q8TAP4-1]
XP_011519065.1, XM_011520763.1 [Q8TAP4-1]

3D structure databases

SMRiQ8TAP4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120977, 39 interactors
DIPiDIP-50129N
IntActiQ8TAP4, 114 interactors
MINTiQ8TAP4

PTM databases

iPTMnetiQ8TAP4
PhosphoSitePlusiQ8TAP4

Polymorphism and mutation databases

BioMutaiLMO3
DMDMi34098603

Proteomic databases

MaxQBiQ8TAP4
PaxDbiQ8TAP4
PRIDEiQ8TAP4
ProteomicsDBi73900

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55885
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261169; ENSP00000261169; ENSG00000048540 [Q8TAP4-3]
ENST00000320122; ENSP00000312856; ENSG00000048540 [Q8TAP4-1]
ENST00000354662; ENSP00000346689; ENSG00000048540 [Q8TAP4-1]
ENST00000441439; ENSP00000412479; ENSG00000048540 [Q8TAP4-1]
ENST00000447609; ENSP00000413703; ENSG00000048540 [Q8TAP4-1]
ENST00000534946; ENSP00000439275; ENSG00000048540 [Q8TAP4-1]
ENST00000535535; ENSP00000446115; ENSG00000048540 [Q8TAP4-1]
ENST00000537304; ENSP00000440099; ENSG00000048540 [Q8TAP4-1]
ENST00000540445; ENSP00000442786; ENSG00000048540 [Q8TAP4-2]
ENST00000540848; ENSP00000445751; ENSG00000048540 [Q8TAP4-1]
ENST00000541295; ENSP00000446463; ENSG00000048540 [Q8TAP4-4]
ENST00000541846; ENSP00000444393; ENSG00000048540 [Q8TAP4-1]
GeneIDi55885
KEGGihsa:55885
UCSCiuc001rdj.3 human [Q8TAP4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55885
DisGeNETi55885

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LMO3
HGNCiHGNC:6643 LMO3
MIMi180386 gene
neXtProtiNX_Q8TAP4
OpenTargetsiENSG00000048540
PharmGKBiPA30409

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0490 Eukaryota
ENOG410YIJ3 LUCA
GeneTreeiENSGT00940000153908
HOGENOMiHOG000232175
InParanoidiQ8TAP4
OMAiXLFGVTG
OrthoDBi1307952at2759
PhylomeDBiQ8TAP4
TreeFamiTF351071

Enzyme and pathway databases

SIGNORiQ8TAP4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LMO3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LMO3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55885

Protein Ontology

More...
PROi
PR:Q8TAP4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000048540 Expressed in 186 organ(s), highest expression level in caudate nucleus
ExpressionAtlasiQ8TAP4 baseline and differential
GenevisibleiQ8TAP4 HS

Family and domain databases

InterProiView protein in InterPro
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 2 hits
SMARTiView protein in SMART
SM00132 LIM, 2 hits
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLMO3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TAP4
Secondary accession number(s): B4DG90
, B4DH35, Q58A66, Q58A67, Q8N974, Q9UDD5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: June 1, 2002
Last modified: July 3, 2019
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again