Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (02 Jun 2021)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

LIM domain only protein 3

Gene

LMO3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8TAP4

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8TAP4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM domain only protein 3
Short name:
LMO-3
Alternative name(s):
Neuronal-specific transcription factor DAT1
Rhombotin-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LMO3
Synonyms:RBTN3, RBTNL2, RHOM3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6643, LMO3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
180386, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TAP4

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000048540.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55885

Open Targets

More...
OpenTargetsi
ENSG00000048540

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30409

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TAP4, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LMO3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
34098603

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758171 – 145LIM domain only protein 3Add BLAST145

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TAP4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TAP4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TAP4

PeptideAtlas

More...
PeptideAtlasi
Q8TAP4

PRoteomics IDEntifications database

More...
PRIDEi
Q8TAP4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
4115
4187
73900 [Q8TAP4-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TAP4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TAP4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000048540, Expressed in caudate nucleus and 201 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TAP4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TAP4, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000048540, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q8TAP4
With#Exp.IntAct
BANP [Q8N9N5]3EBI-742259,EBI-744695
CBY2 [Q8NA61]3EBI-742259,EBI-741724
CEP57L1 - isoform 2 [Q8IYX8-2]3EBI-742259,EBI-10181988
FAM131C [Q96AQ9]3EBI-742259,EBI-741921
FBLIM1 [Q8WUP2]5EBI-742259,EBI-3864120
FOS [Q6FG41]3EBI-742259,EBI-10198738
IKZF1 [Q13422]3EBI-742259,EBI-745305
KCTD1 [Q719H9]3EBI-742259,EBI-9027502
NUTM1 [Q86Y26]3EBI-742259,EBI-10178410
SAMD3 [Q8N6K7]3EBI-742259,EBI-748741
SP4 [Q02446]3EBI-742259,EBI-10198587
TAX1BP1 [Q86VP1]3EBI-742259,EBI-529518
Isoform 4 [Q8TAP4-4]
With#Exp.IntAct
ABI2 - isoform 2 [Q9NYB9-2]3EBI-11742507,EBI-11096309
ACAP1 [Q15027]3EBI-11742507,EBI-751746
ACOT13 [Q9NPJ3]3EBI-11742507,EBI-1045357
AMIGO1 [Q86WK6]3EBI-11742507,EBI-19125216
AMOTL2 [Q9Y2J4]3EBI-11742507,EBI-746752
ANKHD1 - isoform 3 [Q8IWZ3-3]3EBI-11742507,EBI-25833200
ARHGEF9 [O43307]3EBI-11742507,EBI-3447299
ARL6IP4 - isoform 4 [Q66PJ3-4]3EBI-11742507,EBI-5280499
ASB1 [Q9Y576]3EBI-11742507,EBI-2323092
AVPI1 [Q5T686]3EBI-11742507,EBI-8640233
BAAT [Q14032]3EBI-11742507,EBI-8994378
BAGE [Q13072]3EBI-11742507,EBI-25884811
BANP - isoform 2 [Q8N9N5-2]6EBI-11742507,EBI-11524452
BCAS2 [O75934]5EBI-11742507,EBI-1050106
BEND5 [Q7L4P6]3EBI-11742507,EBI-724373
BEND7 - isoform 2 [Q8N7W2-2]7EBI-11742507,EBI-10181188
BHLHE40 [O14503]3EBI-11742507,EBI-711810
BLZF1 [Q9H2G9]3EBI-11742507,EBI-2548012
C16orf87 [Q6PH81]3EBI-11742507,EBI-6598617
C19orf54 - isoform 3 [Q5BKX5-3]3EBI-11742507,EBI-11976299
CARD9 - isoform 2 [Q9H257-2]3EBI-11742507,EBI-11530605
CCDC34 - isoform 2 [Q96HJ3-2]3EBI-11742507,EBI-17641690
CCDC47 [Q96A33]3EBI-11742507,EBI-720151
CCDC74B - isoform 2 [Q96LY2-2]3EBI-11742507,EBI-17967022
CCDC90B [Q9GZT6]3EBI-11742507,EBI-713148
CCSER1 - isoform 2 [Q9C0I3-2]3EBI-11742507,EBI-17793327
CDYL2 [Q8N8U2]3EBI-11742507,EBI-8467076
CENPV [Q7Z7K6]3EBI-11742507,EBI-1210604
CEP57 - isoform 3 [Q86XR8-3]3EBI-11742507,EBI-11752486
CEP76 [Q8TAP6]3EBI-11742507,EBI-742887
CHCHD3 [Q9NX63]3EBI-11742507,EBI-743375
CIB1 [Q99828]3EBI-11742507,EBI-372594
CPN1 [P15169]3EBI-11742507,EBI-2116369
CTSO [P43234]3EBI-11742507,EBI-2874283
CYSRT1 [A8MQ03]3EBI-11742507,EBI-3867333
DCDC2 [Q9UHG0]3EBI-11742507,EBI-10303987
DEXI [O95424]3EBI-11742507,EBI-724515
DNPH1 [O43598]3EBI-11742507,EBI-748674
DRD1 [P21728]3EBI-11742507,EBI-6624459
EIF3E [P60228]3EBI-11742507,EBI-347740
EPSTI1 - isoform 3 [Q96J88-3]3EBI-11742507,EBI-25885343
FBLIM1 [Q8WUP2]3EBI-11742507,EBI-3864120
FOXP4 - isoform 2 [Q8IVH2-2]3EBI-11742507,EBI-25885364
FRMD6 - isoform 2 [Q96NE9-2]3EBI-11742507,EBI-13213391
FSCN2 [O14926]3EBI-11742507,EBI-21017948
GABPB1 - isoform 2 [Q06547-2]3EBI-11742507,EBI-618189
GABPB1 - isoform 3 [Q06547-3]3EBI-11742507,EBI-9088619
GGT1 - isoform 3 [P19440-3]3EBI-11742507,EBI-21558069
GMEB2 [Q9UKD1]3EBI-11742507,EBI-948296
GNA14 [O95837]3EBI-11742507,EBI-7951023
GNB5 [Q96F32]3EBI-11742507,EBI-25902214
GOLGA2 [Q08379]5EBI-11742507,EBI-618309
GOLGA6L9 [A6NEM1]3EBI-11742507,EBI-5916454
GPAA1 - isoform 2 [O43292-2]3EBI-11742507,EBI-25884370
GPATCH2L - isoform 2 [Q9NWQ4-1]6EBI-11742507,EBI-11959863
GPR160 [Q9UJ42]3EBI-11742507,EBI-25885139
GPRASP2 [Q96D09]3EBI-11742507,EBI-473189
GRB10 - isoform 4 [Q13322-4]3EBI-11742507,EBI-12353035
H4C9 [P62805]3EBI-11742507,EBI-302023
HAX1 [O00165]3EBI-11742507,EBI-357001
hCG_1820408 [Q8N7T0]3EBI-11742507,EBI-25858908
HMBOX1 [Q6NT76]3EBI-11742507,EBI-2549423
HNRNPF [P52597]3EBI-11742507,EBI-352986
HNRNPH1 [P31943]3EBI-11742507,EBI-351590
HOXB13 [Q92826]3EBI-11742507,EBI-11317274
HOXC4 [P09017]3EBI-11742507,EBI-3923226
HSF2 - isoform 2 [Q03933-2]3EBI-11742507,EBI-10223348
HSPB2 [Q16082]3EBI-11742507,EBI-739395
ID2 [Q02363]3EBI-11742507,EBI-713450
IFT43 - isoform 2 [Q96FT9-2]3EBI-11742507,EBI-11944538
IGBP1 [P78318]3EBI-11742507,EBI-1055954
IGFBP3 [P17936]3EBI-11742507,EBI-715709
IKZF1 - isoform Ik7 [Q13422-7]3EBI-11742507,EBI-11522367
IL16 - isoform 2 [Q14005-2]3EBI-11742507,EBI-17178971
IL3RA [P26951]3EBI-11742507,EBI-1757512
INCA1 [Q0VD86]5EBI-11742507,EBI-6509505
KANK2 [Q63ZY3]3EBI-11742507,EBI-2556193
KCTD1 [Q719H9]3EBI-11742507,EBI-9027502
KCTD17 [Q8N5Z5]3EBI-11742507,EBI-743960
KIF2A - isoform 1 [O00139-1]3EBI-11742507,EBI-12197879
KLF12 [Q9Y4X4]3EBI-11742507,EBI-750750
KRBOX4 - isoform 3 [Q5JUW0-3]6EBI-11742507,EBI-12893625
KRT31 [Q15323]3EBI-11742507,EBI-948001
KRT38 [O76015]3EBI-11742507,EBI-1047263
KRTAP3-1 [Q9BYR8]3EBI-11742507,EBI-9996449
LDB1 - isoform 3 [Q86U70-2]6EBI-11742507,EBI-11979761
LDB2 [O43679]5EBI-11742507,EBI-2865580
LHX5 [Q9H2C1]3EBI-11742507,EBI-25835523
LIMS1 - isoform 3 [P48059-3]3EBI-11742507,EBI-12864460
LIPT1 [Q9Y234]3EBI-11742507,EBI-727376
LNPK - isoform 2 [Q9C0E8-2]3EBI-11742507,EBI-11024283
LPXN [O60711]3EBI-11742507,EBI-744222
LUM [P51884]3EBI-11742507,EBI-725780
LZTS1 [Q9Y250]3EBI-11742507,EBI-1216080
LZTS2 [Q9BRK4]3EBI-11742507,EBI-741037
MACIR [Q96GV9]3EBI-11742507,EBI-2350695
MAD1L1 [Q9Y6D9]3EBI-11742507,EBI-742610
MAGEH1 [Q9H213]3EBI-11742507,EBI-473834
MALSU1 [Q96EH3]3EBI-11742507,EBI-2339737
MAP3K9 [P80192]3EBI-11742507,EBI-3951604
MAPK11 [Q15759]3EBI-11742507,EBI-298304
MBD3 - isoform 2 [O95983-2]3EBI-11742507,EBI-11978579
MBD3L1 [Q8WWY6]3EBI-11742507,EBI-12516603
MED19 - isoform 2 [A0JLT2-2]3EBI-11742507,EBI-13288755
MEIS3 - isoform 3 [Q99687-3]3EBI-11742507,EBI-18582591
METTL7A [Q9H8H3]3EBI-11742507,EBI-1390168
MID2 - isoform 2 [Q9UJV3-2]3EBI-11742507,EBI-10172526
MNDA [P41218]3EBI-11742507,EBI-2829677
MRPL43 - isoform 3 [Q8N983-3]3EBI-11742507,EBI-11109389
MTUS2 - isoform 2 [Q5JR59-3]3EBI-11742507,EBI-11522433
MYOG [P15173]3EBI-11742507,EBI-3906629
MYOZ3 [Q8TDC0]3EBI-11742507,EBI-5662487
NDOR1 [Q9UHB4]3EBI-11742507,EBI-10249760
NDUFA5 [Q16718]3EBI-11742507,EBI-746417
NDUFV1 [P49821]3EBI-11742507,EBI-748312
NFKBID [Q8NI38]3EBI-11742507,EBI-10271199
NIF3L1 [Q9GZT8]3EBI-11742507,EBI-740897
NTAQ1 [Q96HA8]3EBI-11742507,EBI-741158
OXA1L [Q2M1J6]3EBI-11742507,EBI-9978021
PDCD2 [Q16342]3EBI-11742507,EBI-359462
PELO [Q9BRX2]9EBI-11742507,EBI-1043580
PIAS3 [Q9Y6X2]3EBI-11742507,EBI-2803703
PICK1 [Q9NRD5]3EBI-11742507,EBI-79165
PIP4P1 [Q86T03]3EBI-11742507,EBI-6164623
PLB1 - isoform 2 [Q6P1J6-2]3EBI-11742507,EBI-10694821
PNMA1 [Q8ND90]5EBI-11742507,EBI-302345
POLI [Q9UNA4]3EBI-11742507,EBI-741774
POU6F2 [P78424]3EBI-11742507,EBI-12029004
PPP1R13B [Q96KQ4]3EBI-11742507,EBI-1105153
PROS1 [P07225]3EBI-11742507,EBI-2803380
PXN - isoform Alpha [P49023-2]3EBI-11742507,EBI-11954250
QRICH1 [Q2TAL8]3EBI-11742507,EBI-2798044
RABL6 - isoform 3 [Q3YEC7-3]3EBI-11742507,EBI-25885259
RCC1L [Q96I51]3EBI-11742507,EBI-2117080
RCN1 [Q15293]3EBI-11742507,EBI-948278
RFC5 [P40937]3EBI-11742507,EBI-712376
RHOBTB1 [O94844]3EBI-11742507,EBI-6426999
RIMS3 [Q9UJD0]3EBI-11742507,EBI-3909436
RMND1 - isoform 3 [Q9NWS8-3]3EBI-11742507,EBI-25884400
RNF114 [Q9Y508]3EBI-11742507,EBI-723587
RNF150 - isoform 3 [Q9ULK6-3]3EBI-11742507,EBI-23640835
RPL11 - isoform 2 [P62913-2]3EBI-11742507,EBI-11027771
RPL35A [P18077]3EBI-11742507,EBI-353383
SDHC [Q99643]3EBI-11742507,EBI-1224539
SEPTIN6 [Q14141]3EBI-11742507,EBI-745901
SET - isoform 2 [Q01105-2]3EBI-11742507,EBI-7481343
SH2B2 - isoform 2 [O14492-2]3EBI-11742507,EBI-19952306
SHISA6 [Q6ZSJ9]3EBI-11742507,EBI-12037847
SLAIN1 [Q8ND83]3EBI-11742507,EBI-10269374
SNW1 [Q13573]3EBI-11742507,EBI-632715
SNX10 [Q9Y5X0]3EBI-11742507,EBI-10329478
SNX33 [Q8WV41]3EBI-11742507,EBI-2481535
SOX10 [P56693]3EBI-11742507,EBI-1167533
SP2 [Q9BRW5]3EBI-11742507,EBI-25868254
STIM1 [Q13586]3EBI-11742507,EBI-448878
STRN3 - isoform Alpha [Q13033-2]3EBI-11742507,EBI-1053876
SYNGR3 [O43761]3EBI-11742507,EBI-11321949
TCF4 [P15884]3EBI-11742507,EBI-533224
TCP10L [Q8TDR4]3EBI-11742507,EBI-3923210
TEPSIN [Q96N21]3EBI-11742507,EBI-11139477
TFAP2B [Q92481]3EBI-11742507,EBI-725275
THAP1 [Q9NVV9]3EBI-11742507,EBI-741515
TMEM121 [Q9BTD3]3EBI-11742507,EBI-12155101
TMEM176B [Q3YBM2]3EBI-11742507,EBI-2821479
TMEM54 [Q969K7]3EBI-11742507,EBI-3922833
TPMT [P51580]3EBI-11742507,EBI-25902017
TRAPPC2L - isoform 2 [Q9UL33-2]3EBI-11742507,EBI-11119202
TRIB3 [Q96RU7]3EBI-11742507,EBI-492476
TRIM23 [P36406]3EBI-11742507,EBI-740098
TRIM54 [Q9BYV2]3EBI-11742507,EBI-2130429
TRMT6 [Q9UJA5]3EBI-11742507,EBI-934061
TSNAX [Q99598]3EBI-11742507,EBI-742638
TUFT1 [Q9NNX1]3EBI-11742507,EBI-2557363
USP38 [Q8NB14]3EBI-11742507,EBI-2512509
USP54 - isoform 6 [Q70EL1-9]3EBI-11742507,EBI-11975223
VAMP3 [Q15836]3EBI-11742507,EBI-722343
VBP1 [P61758]3EBI-11742507,EBI-357430
VMAC [Q2NL98]3EBI-11742507,EBI-2803134
VNN2 [O95498]3EBI-11742507,EBI-21494555
VPS28 - isoform 2 [Q9UK41-2]3EBI-11742507,EBI-12146727
WWOX - isoform 5 [Q9NZC7-5]6EBI-11742507,EBI-12040603
ZBTB43 [O43298]3EBI-11742507,EBI-740718
ZBTB8B [Q8NAP8]3EBI-11742507,EBI-17494306
ZC2HC1C - isoform 2 [Q53FD0-2]3EBI-11742507,EBI-14104088
ZFYVE21 [Q9BQ24]3EBI-11742507,EBI-2849569
ZIM3 [Q96PE6]3EBI-11742507,EBI-18199075
ZKSCAN8 [Q15776]3EBI-11742507,EBI-2602314
ZMYM3 [Q14202]3EBI-11742507,EBI-2556139
ZNF143 [P52747]3EBI-11742507,EBI-2849334
ZNF248 [Q05CR2]3EBI-11742507,EBI-25835471
ZNF346 [Q9UL40]3EBI-11742507,EBI-2462313
ZNF444 - isoform 2 [Q8N0Y2-2]3EBI-11742507,EBI-12010736
ZNF526 [Q8TF50]3EBI-11742507,EBI-11035148
ZNF587 [Q96SQ5]3EBI-11742507,EBI-6427977
ZNF620 [Q6ZNG0]3EBI-11742507,EBI-4395669
ZNF641 - isoform 2 [Q96N77-2]3EBI-11742507,EBI-12939666
ZNF69 - isoform 2 [Q9UC07-2]3EBI-11742507,EBI-12310821
ZNF84 [P51523]3EBI-11742507,EBI-2849074
ZRANB1 [Q9UGI0]3EBI-11742507,EBI-527853
ZSCAN9 [O15535]6EBI-11742507,EBI-751531
Q9HBH63EBI-11742507,EBI-25901704

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120977, 128 interactors

Database of interacting proteins

More...
DIPi
DIP-50129N

Protein interaction database and analysis system

More...
IntActi
Q8TAP4, 225 interactors

Molecular INTeraction database

More...
MINTi
Q8TAP4

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8TAP4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TAP4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini11 – 73LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST63
Domaini75 – 137LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST63

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153908

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001357_7_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TAP4

Identification of Orthologs from Complete Genome Data

More...
OMAi
DCRLGEN

Database of Orthologous Groups

More...
OrthoDBi
1307952at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TAP4

TreeFam database of animal gene trees

More...
TreeFami
TF351071

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001781, Znf_LIM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00412, LIM, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132, LIM, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TAP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSVQPDTKP KGCAGCNRKI KDRYLLKALD KYWHEDCLKC ACCDCRLGEV
60 70 80 90 100
GSTLYTKANL ILCRRDYLRL FGVTGNCAAC SKLIPAFEMV MRAKDNVYHL
110 120 130 140
DCFACQLCNQ RFCVGDKFFL KNNMILCQTD YEEGLMKEGY APQVR
Length:145
Mass (Da):16,594
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i05284546BA5EC226
GO
Isoform 2 (identifier: Q8TAP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-69: VGSTLYTKANLILCRRDYLR → HLKRCGSIYIHAAHTEIGICVTLEWPLPFVIIDFSQQITIAW

Show »
Length:167
Mass (Da):19,059
Checksum:i15DF48CDCE2DB95F
GO
Isoform 3 (identifier: Q8TAP4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQKKEKSFGIQM

Show »
Length:156
Mass (Da):17,899
Checksum:i57C8202A34AF191D
GO
Isoform 4 (identifier: Q8TAP4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLMEGGRAAAARNVSSIQM

Show »
Length:163
Mass (Da):18,438
Checksum:i63D462FD89CCBE05
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q05D86Q05D86_HUMAN
LIM domain only protein 3
LMO3
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GYZ6F5GYZ6_HUMAN
LIM domain only protein 3
LMO3
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6TDU8F6TDU8_HUMAN
LIM domain only protein 3
LMO3
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JE61C9JE61_HUMAN
LIM domain only protein 3
LMO3
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GZR3F5GZR3_HUMAN
LIM domain only protein 3
LMO3
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H2N9F5H2N9_HUMAN
LIM domain only protein 3
LMO3
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3S4F5H3S4_HUMAN
LIM domain only protein 3
LMO3
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4K9F5H4K9_HUMAN
LIM domain only protein 3
LMO3
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4T0F5H4T0_HUMAN
LIM domain only protein 3
LMO3
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H655F5H655_HUMAN
LIM domain only protein 3
LMO3
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29L → P in BAC04582 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0453121M → MQKKEKSFGIQM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0473791M → MLMEGGRAAAARNVSSIQM in isoform 4. 1 Publication1
Alternative sequenceiVSP_04531350 – 69VGSTL…RDYLR → HLKRCGSIYIHAAHTEIGIC VTLEWPLPFVIIDFSQQITI AW in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB044745 mRNA Translation: BAD93349.1
AB044746 mRNA Translation: BAD93350.1
AK095595 mRNA Translation: BAC04582.1
AK294474 mRNA Translation: BAG57701.1
AK294909 mRNA Translation: BAG57996.1
AK316021 mRNA Translation: BAH14392.1
AC007529 Genomic DNA No translation available.
AC007552 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96371.1
BC026311 mRNA Translation: AAH26311.1
BC050085 mRNA Translation: AAH50085.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58210.1 [Q8TAP4-2]
CCDS58211.1 [Q8TAP4-3]
CCDS58212.1 [Q8TAP4-4]
CCDS8678.1 [Q8TAP4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001001395.1, NM_001001395.2 [Q8TAP4-1]
NP_001230538.1, NM_001243609.1 [Q8TAP4-1]
NP_001230539.1, NM_001243610.1 [Q8TAP4-1]
NP_001230540.1, NM_001243611.1 [Q8TAP4-3]
NP_001230541.1, NM_001243612.1 [Q8TAP4-4]
NP_001230542.1, NM_001243613.1 [Q8TAP4-2]
NP_061110.2, NM_018640.4 [Q8TAP4-1]
XP_006719173.1, XM_006719110.3 [Q8TAP4-1]
XP_006719174.1, XM_006719111.2 [Q8TAP4-1]
XP_011519064.1, XM_011520762.1 [Q8TAP4-1]
XP_011519065.1, XM_011520763.1 [Q8TAP4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261169; ENSP00000261169; ENSG00000048540 [Q8TAP4-3]
ENST00000320122; ENSP00000312856; ENSG00000048540 [Q8TAP4-1]
ENST00000354662; ENSP00000346689; ENSG00000048540 [Q8TAP4-1]
ENST00000441439; ENSP00000412479; ENSG00000048540 [Q8TAP4-1]
ENST00000447609; ENSP00000413703; ENSG00000048540 [Q8TAP4-1]
ENST00000534946; ENSP00000439275; ENSG00000048540 [Q8TAP4-1]
ENST00000535535; ENSP00000446115; ENSG00000048540 [Q8TAP4-1]
ENST00000537304; ENSP00000440099; ENSG00000048540 [Q8TAP4-1]
ENST00000540445; ENSP00000442786; ENSG00000048540 [Q8TAP4-2]
ENST00000540848; ENSP00000445751; ENSG00000048540 [Q8TAP4-1]
ENST00000541295; ENSP00000446463; ENSG00000048540 [Q8TAP4-4]
ENST00000541846; ENSP00000444393; ENSG00000048540 [Q8TAP4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55885

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55885

UCSC genome browser

More...
UCSCi
uc001rdj.3, human [Q8TAP4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044745 mRNA Translation: BAD93349.1
AB044746 mRNA Translation: BAD93350.1
AK095595 mRNA Translation: BAC04582.1
AK294474 mRNA Translation: BAG57701.1
AK294909 mRNA Translation: BAG57996.1
AK316021 mRNA Translation: BAH14392.1
AC007529 Genomic DNA No translation available.
AC007552 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96371.1
BC026311 mRNA Translation: AAH26311.1
BC050085 mRNA Translation: AAH50085.1
CCDSiCCDS58210.1 [Q8TAP4-2]
CCDS58211.1 [Q8TAP4-3]
CCDS58212.1 [Q8TAP4-4]
CCDS8678.1 [Q8TAP4-1]
RefSeqiNP_001001395.1, NM_001001395.2 [Q8TAP4-1]
NP_001230538.1, NM_001243609.1 [Q8TAP4-1]
NP_001230539.1, NM_001243610.1 [Q8TAP4-1]
NP_001230540.1, NM_001243611.1 [Q8TAP4-3]
NP_001230541.1, NM_001243612.1 [Q8TAP4-4]
NP_001230542.1, NM_001243613.1 [Q8TAP4-2]
NP_061110.2, NM_018640.4 [Q8TAP4-1]
XP_006719173.1, XM_006719110.3 [Q8TAP4-1]
XP_006719174.1, XM_006719111.2 [Q8TAP4-1]
XP_011519064.1, XM_011520762.1 [Q8TAP4-1]
XP_011519065.1, XM_011520763.1 [Q8TAP4-1]

3D structure databases

SMRiQ8TAP4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi120977, 128 interactors
DIPiDIP-50129N
IntActiQ8TAP4, 225 interactors
MINTiQ8TAP4

PTM databases

iPTMnetiQ8TAP4
PhosphoSitePlusiQ8TAP4

Genetic variation databases

BioMutaiLMO3
DMDMi34098603

Proteomic databases

MassIVEiQ8TAP4
MaxQBiQ8TAP4
PaxDbiQ8TAP4
PeptideAtlasiQ8TAP4
PRIDEiQ8TAP4
ProteomicsDBi4115
4187
73900 [Q8TAP4-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
23835, 274 antibodies

The DNASU plasmid repository

More...
DNASUi
55885

Genome annotation databases

EnsembliENST00000261169; ENSP00000261169; ENSG00000048540 [Q8TAP4-3]
ENST00000320122; ENSP00000312856; ENSG00000048540 [Q8TAP4-1]
ENST00000354662; ENSP00000346689; ENSG00000048540 [Q8TAP4-1]
ENST00000441439; ENSP00000412479; ENSG00000048540 [Q8TAP4-1]
ENST00000447609; ENSP00000413703; ENSG00000048540 [Q8TAP4-1]
ENST00000534946; ENSP00000439275; ENSG00000048540 [Q8TAP4-1]
ENST00000535535; ENSP00000446115; ENSG00000048540 [Q8TAP4-1]
ENST00000537304; ENSP00000440099; ENSG00000048540 [Q8TAP4-1]
ENST00000540445; ENSP00000442786; ENSG00000048540 [Q8TAP4-2]
ENST00000540848; ENSP00000445751; ENSG00000048540 [Q8TAP4-1]
ENST00000541295; ENSP00000446463; ENSG00000048540 [Q8TAP4-4]
ENST00000541846; ENSP00000444393; ENSG00000048540 [Q8TAP4-1]
GeneIDi55885
KEGGihsa:55885
UCSCiuc001rdj.3, human [Q8TAP4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55885
DisGeNETi55885

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LMO3
HGNCiHGNC:6643, LMO3
HPAiENSG00000048540, Tissue enhanced (brain)
MIMi180386, gene
neXtProtiNX_Q8TAP4
OpenTargetsiENSG00000048540
PharmGKBiPA30409
VEuPathDBiHostDB:ENSG00000048540.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000153908
HOGENOMiCLU_001357_7_1_1
InParanoidiQ8TAP4
OMAiDCRLGEN
OrthoDBi1307952at2759
PhylomeDBiQ8TAP4
TreeFamiTF351071

Enzyme and pathway databases

PathwayCommonsiQ8TAP4
SIGNORiQ8TAP4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
55885, 3 hits in 985 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LMO3, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LMO3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55885
PharosiQ8TAP4, Tbio

Protein Ontology

More...
PROi
PR:Q8TAP4
RNActiQ8TAP4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000048540, Expressed in caudate nucleus and 201 other tissues
ExpressionAtlasiQ8TAP4, baseline and differential
GenevisibleiQ8TAP4, HS

Family and domain databases

InterProiView protein in InterPro
IPR001781, Znf_LIM
PfamiView protein in Pfam
PF00412, LIM, 2 hits
SMARTiView protein in SMART
SM00132, LIM, 2 hits
PROSITEiView protein in PROSITE
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLMO3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TAP4
Secondary accession number(s): B4DG90
, B4DH35, Q58A66, Q58A67, Q8N974, Q9UDD5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: June 1, 2002
Last modified: June 2, 2021
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again