Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rieske domain-containing protein

Gene

RFESD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

[2Fe-2S] clusterPROSITE-ProRule annotationNote: Binds 1 [2Fe-2S] cluster per subunit.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi57Iron-sulfur (2Fe-2S)PROSITE-ProRule annotation1
Metal bindingi59Iron-sulfur (2Fe-2S); via pros nitrogenPROSITE-ProRule annotation1
Metal bindingi80Iron-sulfur (2Fe-2S)PROSITE-ProRule annotation1
Metal bindingi83Iron-sulfur (2Fe-2S); via pros nitrogenPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • 2 iron, 2 sulfur cluster binding Source: GO_Central
  • metal ion binding Source: UniProtKB-KW
  • oxidoreductase activity Source: InterPro

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Ligand2Fe-2S, Iron, Iron-sulfur, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rieske domain-containing protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RFESD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000175449.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29587 RFESD

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TAC1

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000175449

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162401171

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RFESD

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74730342

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003138131 – 157Rieske domain-containing proteinAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei6PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TAC1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TAC1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TAC1

PeptideAtlas

More...
PeptideAtlasi
Q8TAC1

PRoteomics IDEntifications database

More...
PRIDEi
Q8TAC1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
73854

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TAC1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TAC1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000175449 Expressed in 123 organ(s), highest expression level in liver

CleanEx database of gene expression profiles

More...
CleanExi
HS_RFESD

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TAC1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TAC1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB016546

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
HBQ1P091055EBI-10271664,EBI-10193656

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
130435, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TAC1, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369341

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8TAC1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TAC1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini16 – 94Rieske 1PROSITE-ProRule annotationAdd BLAST79
Domaini17 – 131Rieske 2PROSITE-ProRule annotationAdd BLAST115

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IWA6 Eukaryota
ENOG4111Q5H LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018225

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000128541

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG061590

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TAC1

Identification of Orthologs from Complete Genome Data

More...
OMAi
WCSKGVK

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0S2K

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TAC1

TreeFam database of animal gene trees

More...
TreeFami
TF333320

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.102.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017941 Rieske_2Fe-2S
IPR036922 Rieske_2Fe-2S_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00355 Rieske, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50022 SSF50022, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51296 RIESKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TAC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNLDGSAQDP EKREYSSVCV GREDDIKKSE RMTAVVHDRE VVIFYHKGEY
60 70 80 90 100
HAMDIRCYHS GGPLHLGDIE DFDGRPCIVC PWHKYKITLA TGEGLYQSIN
110 120 130 140 150
PKDPSAKPKW CSKGIKQRIH TVTVDNGNIY VTLSNEPFKC DSDFYATGDF

KVIKSSS
Length:157
Mass (Da):17,762
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE959948673E776F8
GO
Isoform 2 (identifier: Q8TAC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLKCFRNCLRPSSLSTLPLQYGILFPKLLACLVHLHFGHFSSAVISVTSFYLSM

Note: No experimental confirmation available.
Show »
Length:210
Mass (Da):23,702
Checksum:iD917F08DC8C08536
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBY0D6RBY0_HUMAN
Rieske domain-containing protein
RFESD
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJG8D6RJG8_HUMAN
Rieske domain-containing protein
RFESD
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0444521M → MLKCFRNCLRPSSLSTLPLQ YGILFPKLLACLVHLHFGHF SSAVISVTSFYLSM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC008547 Genomic DNA No translation available.
CH471084 Genomic DNA Translation: EAW96043.1
CH471084 Genomic DNA Translation: EAW96045.1
BC024023 mRNA Translation: AAH24023.1
BC035110 mRNA Translation: AAH35110.1
BC048979 mRNA Translation: AAH48979.1
BM263054 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4075.1 [Q8TAC1-1]
CCDS47248.1 [Q8TAC1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001124537.1, NM_001131065.1 [Q8TAC1-2]
NP_001124538.1, NM_001131066.1 [Q8TAC1-2]
NP_775498.1, NM_173362.3 [Q8TAC1-1]
XP_011541662.1, XM_011543360.2 [Q8TAC1-2]
XP_011541663.1, XM_011543361.2 [Q8TAC1-1]
XP_016864902.1, XM_017009413.1 [Q8TAC1-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.399758

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000311364; ENSP00000309229; ENSG00000175449 [Q8TAC1-1]
ENST00000380005; ENSP00000369341; ENSG00000175449 [Q8TAC1-2]
ENST00000458310; ENSP00000413592; ENSG00000175449 [Q8TAC1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
317671

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:317671

UCSC genome browser

More...
UCSCi
uc003klf.4 human [Q8TAC1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC008547 Genomic DNA No translation available.
CH471084 Genomic DNA Translation: EAW96043.1
CH471084 Genomic DNA Translation: EAW96045.1
BC024023 mRNA Translation: AAH24023.1
BC035110 mRNA Translation: AAH35110.1
BC048979 mRNA Translation: AAH48979.1
BM263054 mRNA No translation available.
CCDSiCCDS4075.1 [Q8TAC1-1]
CCDS47248.1 [Q8TAC1-2]
RefSeqiNP_001124537.1, NM_001131065.1 [Q8TAC1-2]
NP_001124538.1, NM_001131066.1 [Q8TAC1-2]
NP_775498.1, NM_173362.3 [Q8TAC1-1]
XP_011541662.1, XM_011543360.2 [Q8TAC1-2]
XP_011541663.1, XM_011543361.2 [Q8TAC1-1]
XP_016864902.1, XM_017009413.1 [Q8TAC1-2]
UniGeneiHs.399758

3D structure databases

ProteinModelPortaliQ8TAC1
SMRiQ8TAC1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130435, 7 interactors
IntActiQ8TAC1, 1 interactor
STRINGi9606.ENSP00000369341

PTM databases

iPTMnetiQ8TAC1
PhosphoSitePlusiQ8TAC1

Polymorphism and mutation databases

BioMutaiRFESD
DMDMi74730342

Proteomic databases

EPDiQ8TAC1
MaxQBiQ8TAC1
PaxDbiQ8TAC1
PeptideAtlasiQ8TAC1
PRIDEiQ8TAC1
ProteomicsDBi73854

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
317671
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311364; ENSP00000309229; ENSG00000175449 [Q8TAC1-1]
ENST00000380005; ENSP00000369341; ENSG00000175449 [Q8TAC1-2]
ENST00000458310; ENSP00000413592; ENSG00000175449 [Q8TAC1-2]
GeneIDi317671
KEGGihsa:317671
UCSCiuc003klf.4 human [Q8TAC1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
317671
EuPathDBiHostDB:ENSG00000175449.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RFESD
HGNCiHGNC:29587 RFESD
HPAiCAB016546
neXtProtiNX_Q8TAC1
OpenTargetsiENSG00000175449
PharmGKBiPA162401171

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IWA6 Eukaryota
ENOG4111Q5H LUCA
GeneTreeiENSGT00390000018225
HOGENOMiHOG000128541
HOVERGENiHBG061590
InParanoidiQ8TAC1
OMAiWCSKGVK
OrthoDBiEOG091G0S2K
PhylomeDBiQ8TAC1
TreeFamiTF333320

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
317671

Protein Ontology

More...
PROi
PR:Q8TAC1

Gene expression databases

BgeeiENSG00000175449 Expressed in 123 organ(s), highest expression level in liver
CleanExiHS_RFESD
ExpressionAtlasiQ8TAC1 baseline and differential
GenevisibleiQ8TAC1 HS

Family and domain databases

Gene3Di2.102.10.10, 1 hit
InterProiView protein in InterPro
IPR017941 Rieske_2Fe-2S
IPR036922 Rieske_2Fe-2S_sf
PfamiView protein in Pfam
PF00355 Rieske, 1 hit
SUPFAMiSSF50022 SSF50022, 1 hit
PROSITEiView protein in PROSITE
PS51296 RIESKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRFESD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TAC1
Secondary accession number(s): J3KPH1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: June 1, 2002
Last modified: November 7, 2018
This is version 117 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again