Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 142 (18 Sep 2019)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 563

Gene

ZNF563

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri101 – 125C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri169 – 191C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri197 – 219C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri225 – 247C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri253 – 275C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri281 – 303C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri309 – 331C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri337 – 359C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri365 – 387C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri393 – 415C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri421 – 443C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri449 – 471C2H2-type 12PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 563
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF563
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30498 ZNF563

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TA94

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000188868

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134949077

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF563

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762598

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000476531 – 476Zinc finger protein 563Add BLAST476

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TA94

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TA94

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TA94

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TA94

PeptideAtlas

More...
PeptideAtlasi
Q8TA94

PRoteomics IDEntifications database

More...
PRIDEi
Q8TA94

ProteomicsDB human proteome resource

More...
ProteomicsDBi
73841 [Q8TA94-1]
73842 [Q8TA94-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TA94

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TA94

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188868 Expressed in 131 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TA94 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TA94 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042136

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127092, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TA94, 10 interactors

Molecular INTeraction database

More...
MINTi
Q8TA94

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000293725

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TA94

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 96KRABPROSITE-ProRule annotationAdd BLAST93

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri101 – 125C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri169 – 191C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri197 – 219C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri225 – 247C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri253 – 275C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri281 – 303C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri309 – 331C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri337 – 359C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri365 – 387C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri393 – 415C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri421 – 443C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri449 – 471C2H2-type 12PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182755

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234617

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TA94

KEGG Orthology (KO)

More...
KOi
K09228

Identification of Orthologs from Complete Genome Data

More...
OMAi
FVYPSVC

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TA94

TreeFam database of animal gene trees

More...
TreeFami
TF338854

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07765 KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 9 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 11 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 7 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 10 hits
PS50157 ZINC_FINGER_C2H2_2, 12 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TA94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAVAFEDVA VNFTQEEWAL LGPSQKNLYR YVMQETIRNL DCIRMIWEEQ
60 70 80 90 100
NTEDQYKNPR RNLRCHMVER FSESKDSSQC GETFSLIRDS IVNNSICPGE
110 120 130 140 150
DPCQSAECEE VIMGHLSLNS HIRVDSGHKP HEYQEYGEKP HTHKQRGKAF
160 170 180 190 200
SYHHSFQSRG RPHTGKKRYE CKECGKTFSS RRNLRRHMVV QGGNRPYKCK
210 220 230 240 250
LCGKAFFWPS LLRMHERTHT GEKPYECKQC SKAFPFYSSY RRHERMHTGE
260 270 280 290 300
KPYECKQCSK ALPDSSSYIR HERTHTGEKP YTCKQCGKAF SVSSSLRRHE
310 320 330 340 350
TTHSAEKPYE CKQCGKTFHH LGSFQIHMKR HTGDRPHKCK ICGKGFDRPS
360 370 380 390 400
LVRYHERIHT GEKPYECKQC GKTLSHSSSF RRHMIMHTGG GPHKCKICGK
410 420 430 440 450
AFVYPSVCQR HEKSHSGEKP YECKQCGKAL SHSSSFRRHM VMHTGDGPNK
460 470
CKVCGKAFVY PSVCQRHEKT HWRETI
Length:476
Mass (Da):55,434
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i02F71928C37166B2
GO
Isoform 2 (identifier: Q8TA94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     199-229: CKLCGKAFFWPSLLRMHERTHTGEKPYECKQ → FPIEDMRECTLGRNRMNVSSVLKPCLIPVP
     230-476: Missing.

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):26,624
Checksum:iD9D770346841D117
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R1Q6M0R1Q6_HUMAN
Zinc finger protein 563
ZNF563
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGQ9A0A0C4DGQ9_HUMAN
Zinc finger protein 563
ZNF563
229Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1L6M0R1L6_HUMAN
Zinc finger protein 563
ZNF563
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016381199 – 229CKLCG…YECKQ → FPIEDMRECTLGRNRMNVSS VLKPCLIPVP in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_016382230 – 476Missing in isoform 2. 1 PublicationAdd BLAST247

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK092116 mRNA Translation: BAC03810.1
AK313755 mRNA Translation: BAG36494.1
CH471106 Genomic DNA Translation: EAW84268.1
BC022523 mRNA Translation: AAH22523.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12270.1 [Q8TA94-1]

NCBI Reference Sequences

More...
RefSeqi
NP_660319.1, NM_145276.2 [Q8TA94-1]
XP_005259808.1, XM_005259751.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000293725; ENSP00000293725; ENSG00000188868 [Q8TA94-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
147837

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:147837

UCSC genome browser

More...
UCSCi
uc002mtp.4 human [Q8TA94-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092116 mRNA Translation: BAC03810.1
AK313755 mRNA Translation: BAG36494.1
CH471106 Genomic DNA Translation: EAW84268.1
BC022523 mRNA Translation: AAH22523.1
CCDSiCCDS12270.1 [Q8TA94-1]
RefSeqiNP_660319.1, NM_145276.2 [Q8TA94-1]
XP_005259808.1, XM_005259751.3

3D structure databases

SMRiQ8TA94
ModBaseiSearch...

Protein-protein interaction databases

BioGridi127092, 9 interactors
IntActiQ8TA94, 10 interactors
MINTiQ8TA94
STRINGi9606.ENSP00000293725

PTM databases

iPTMnetiQ8TA94
PhosphoSitePlusiQ8TA94

Polymorphism and mutation databases

BioMutaiZNF563
DMDMi74762598

Proteomic databases

jPOSTiQ8TA94
MassIVEiQ8TA94
MaxQBiQ8TA94
PaxDbiQ8TA94
PeptideAtlasiQ8TA94
PRIDEiQ8TA94
ProteomicsDBi73841 [Q8TA94-1]
73842 [Q8TA94-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
147837
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000293725; ENSP00000293725; ENSG00000188868 [Q8TA94-1]
GeneIDi147837
KEGGihsa:147837
UCSCiuc002mtp.4 human [Q8TA94-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
147837

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF563
HGNCiHGNC:30498 ZNF563
HPAiHPA042136
neXtProtiNX_Q8TA94
OpenTargetsiENSG00000188868
PharmGKBiPA134949077

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00950000182755
HOGENOMiHOG000234617
InParanoidiQ8TA94
KOiK09228
OMAiFVYPSVC
OrthoDBi1318335at2759
PhylomeDBiQ8TA94
TreeFamiTF338854

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF563 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
147837

Pharos

More...
Pharosi
Q8TA94

Protein Ontology

More...
PROi
PR:Q8TA94

Gene expression databases

BgeeiENSG00000188868 Expressed in 131 organ(s), highest expression level in testis
ExpressionAtlasiQ8TA94 baseline and differential
GenevisibleiQ8TA94 HS

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 9 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 11 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 10 hits
PS50157 ZINC_FINGER_C2H2_2, 12 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN563_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TA94
Secondary accession number(s): B2R9E7, Q8NAT7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: June 1, 2002
Last modified: September 18, 2019
This is version 142 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again