Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (29 Sep 2021)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Neprilysin-4

Gene

Nep4

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metalloendoprotease which cleaves peptides at the amino side of hydrophobic residues - such as the hormones Akh and Dh31, and the neuropeptides Allatostatins (AST1, AST2, AST3 and AST4), Crz, Drosulfakinins (DSK-I and DSK-II), Lk, sNPF and the tachykinin peptides TK-1, TK-2, TK-4 and TK-5 (PubMed:27919317).

Functions in female fertility, memory formation and may also act in regulating insulin signaling and food intake (PubMed:24395329, PubMed:27629706).

Likely to be involved in controlling feeding behavior and the expression of insulin-like peptides by cleaving various regulatory peptides that include certain Drosulfakinins, Allatostatins and tachykinin peptides (PubMed:27919317).

Required in females for normal patterns of egg laying and hatching (PubMed:24395329).

Required in the dorsal paired medial neurons for the proper formation of long-term (LTM) and middle-term memories (MTM) (PubMed:27629706).

Also required in the mushroom body neurons where it functions redundantly with neprilysins Nep2 and Nep3, in normal LTM formation (PubMed:27629706).

3 Publications

Cleaves angiotensin-1 and tachykinin neuropeptide substance P (PubMed:19880729).

Functions in maintaining muscle integrity, possibly independently of its endopeptidase activity (PubMed:22583317).

2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>pH dependencei

Optimum pH is 7.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi872Zinc; catalyticPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei873PROSITE-ProRule annotation1
Metal bindingi876Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi934Zinc; catalyticPROSITE-ProRule annotation1
Active sitei938Proton donorPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.4.24.11, 1994

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M13.014

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neprilysin-41 Publication (EC:3.4.24.111 Publication)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nep41 PublicationImported
ORF Names:CG4058Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0038818, Nep4

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
VectorBase:FBgn0038818

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 55CytoplasmicCuratedAdd BLAST55
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei56 – 76Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini77 – 1040ExtracellularCuratedAdd BLAST964

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Sarcoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown females lay fewer eggs and display a reduced hatch rate when mated to wild-type males (PubMed:24395329). Wild-type females mated to males that undergo RNAi-mediated knockdown, lay the same number of eggs and have a similar hatch rate to those mated to wild-type males (PubMed:24395329). RNAi-mediated knockdown in the dorsal paired medial neurons impairs middle-term (MTM) and long-term memory (LTM), but has no effect on normal aversion learning and anesthesia-resistant memory (ARM) (PubMed:27629706). RNAi-mediated knockdown in all mushroom body neurons has no effect on learning, ARM and LTM (PubMed:27629706). However, simultaneous knockdown with Nep3 does impair LTM, and simultaneous knockdown with both Nep2 and Nep3 results in a further reduction in LTM formation (PubMed:27629706). However, simultaneous knockdown with only Nep2 has no effect on LTM formation (PubMed:27629706). RNAi-mediated knockdown in somatic muscles is pupal lethal (PubMed:22583317, PubMed:27919317). Muscles of second instar larvae display signs of necrotic degeneration, and undergo fewer and weaker contractions leading to a reduction in their crawling speed (PubMed:22583317). Also displays reduced food intake after 10 mins (47% of control intake) and 20 mins of feeding (72% of control intake), but not after 40 mins (PubMed:27919317). Displays an 82% reduction in expression of insulin-like peptide 4 (PubMed:27919317).4 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi873E → Q: No effect on its function in maintaining muscle integrity. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004419931 – 1040Neprilysin-4Add BLAST1040

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi277 ↔ 1025PROSITE-ProRule annotation
Disulfide bondi285 ↔ 985PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi387N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Disulfide bondi452 ↔ 700PROSITE-ProRule annotation
Glycosylationi593N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi723N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi819N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Disulfide bondi909 ↔ 1037PROSITE-ProRule annotation
Glycosylationi916N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi969N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8T062

PRoteomics IDEntifications database

More...
PRIDEi
Q8T062

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the gonads and testes of adults, and the adult and larval brain (at protein level) (PubMed:19880729). In embryos, expressed in the pericardial, muscle founder and glia cells (at protein level) (PubMed:19880729). In stage 12 embryos, expressed in specific dorsal muscle founder cells such as DA1 and DO2, and also in the certain pericardial progenitor cells where expression persists throughout embryogenesis (PubMed:19880729, PubMed:24395329). Expressed in the glia cells of the embryonic, larval and adult central nervous system (PubMed:19880729, PubMed:24395329). Expressed in the somatic muscles of larvae, pupae and adults (PubMed:22583317). Isoform A: Detected in the male abdomen (at protein level) (PubMed:19880729). Isoform B: Not detected in the male or female abdomen (at protein level) (PubMed:19880729).3 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed throughout development and in adults (at protein level). Isoform A: Highly expressed in adults and low levels of expression in larvae and pupae (at protein level). Isoform B: High levels of expression in larvae (at protein level), and low levels of expression in embryos (4-24 hr after oviposition), pupae and adults (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0038818, Expressed in seminal fluid secreting gland and 31 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via intracellular domain) with the putative carbohydrate kinase CG3534.

1 Publication

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0083345

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini251 – 1040Peptidase M13PROSITE-ProRule annotationAdd BLAST790

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 45Required for maintaining muscle integrity1 PublicationAdd BLAST45
Regioni1 – 27DisorderedSequence analysisAdd BLAST27

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M13 family.PROSITE-ProRule annotationCurated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3624, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000171376

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8T062

Identification of Orthologs from Complete Genome Data

More...
OMAi
DGNLHRW

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8T062

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08662, M13, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1380.10, 1 hit
3.40.390.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024079, MetalloPept_cat_dom_sf
IPR000718, Peptidase_M13
IPR018497, Peptidase_M13_C
IPR042089, Peptidase_M13_dom_2
IPR008753, Peptidase_M13_N

The PANTHER Classification System

More...
PANTHERi
PTHR11733, PTHR11733, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01431, Peptidase_M13, 1 hit
PF05649, Peptidase_M13_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00786, NEPRILYSIN

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51885, NEPRILYSIN, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative initiation. AlignAdd to basket
Isoform A1 Publication (identifier: Q8T062-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRHSQLKLA MPSVHGAPAT APGSPMNAKA RSVKLGLGVN QRTGRVQWCP
60 70 80 90 100
GLTCCKMLLL LPVVMLPLTL VLILIMRLDG MLAALQLNEQ RMRDLRNSHS
110 120 130 140 150
EVPVYMEDYE ALLPEGSTYN DLINEEFILP ASKRTQLQIL AAERARRCQP
160 170 180 190 200
YRYGNGESME LEERNTLMKD SRTSFLPLGI PRECLGSGIE LDIKPIDEEA
210 220 230 240 250
YQRQKKRYQD IAPYWLEKIR IRERREAERH AEEASAEISE ATAALQSFWN
260 270 280 290 300
EEGTREGIRM TQAKTMKRYM DNKVDPCVDF YKYACGNWER LHPIPKDKAG
310 320 330 340 350
FDTFEMLRES LDLVLRNLLE KNTPVHSAAE LRKSPVRNTL FKLNEQGEGE
360 370 380 390 400
GEADQAAELT AERLRRHIVS KRQLLNRVLV RYKRYTNGTK RKRLIETPRE
410 420 430 440 450
RTKEEEAAPP VVLPKDKTKD KSDNEEQLHV PTDFLKPHQD AQLKAKNLYR
460 470 480 490 500
SCVNSAVLAK RGLEPLHTLI RELGGWPVLE SQWSESNFNW QVLAATLRRY
510 520 530 540 550
NNDILIVQWV GADIKNSEEN IVQFDQTGLG LPTREYFLQP SNAKYLQAYQ
560 570 580 590 600
RYMAEVMHKM GASKADAQRV ASELVAFETQ LAGITAPAEQ RLNVTKLYKR
610 620 630 640 650
MTLDQLQAVV PEIKWRAYLQ SLQDREVLGT EEVVIYAVEY MSKLVTLLDE
660 670 680 690 700
TDPRTVSNYM MWRFVRHRIN NVDDRFDDIK QSFYHALFGR EESPQRWKVC
710 720 730 740 750
IAQVNTNMGM AVGSMFVSRY FDNNSKRDTL RMTHDLQQAF RDILKTTDWL
760 770 780 790 800
DDTTKQLAEE KVNAMSLKIG YPDFILNPSE LNSKYAGIEI YPEKYFENTL
810 820 830 840 850
NVLLHTAKTE QAKLHERVNK TNWQTAPAIV NAYYSRNKNQ IMFPAGILQP
860 870 880 890 900
PFYHRHFPKS LNFGGIGVVI GHELTHGFDD KGRLFDRNGN IHKWWTDSSI
910 920 930 940 950
RGFDERARCI IAQYSNYTVE EVGIVLNGES TQGENIADNG GLRQAFHAYQ
960 970 980 990 1000
RWLKEHPSEV SDEILPGLNM TGPQLFFLNF GQVWCGAMRP EAIRNKLNTA
1010 1020 1030 1040
IHSPGRFRVI GTLSNSVDFA REFNCPLGSP MNPQKKCSVW
Length:1,040
Mass (Da):119,577
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i48BE8CD06433AE57
GO
Isoform B1 Publication (identifier: Q8T062-2) [UniParc]FASTAAdd to basket
Also known as: CImported

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MSRHSQLKLAMPSVHGAPATAPGSPMNAKARSVKLGLGVNQRTGRVQWCPGLTCCKMLLLLPV → M

Show »
Length:978
Mass (Da):113,059
Checksum:i7FC3736DAD434FD5
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0591561 – 63MSRHS…LLLPV → M in isoform B. CuratedAdd BLAST63

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE014297 Genomic DNA Translation: AAG22165.3
AE014297 Genomic DNA Translation: AAN14361.2
AE014297 Genomic DNA Translation: AGB96153.1
AY069535 mRNA Translation: AAL39680.1
BT099713 mRNA Translation: ACV53077.1

NCBI Reference Sequences

More...
RefSeqi
NP_001262773.1, NM_001275844.1 [Q8T062-2]
NP_650904.3, NM_142647.3 [Q8T062-1]
NP_732540.2, NM_169912.1 [Q8T062-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0083936; FBpp0083344; FBgn0038818 [Q8T062-2]
FBtr0083937; FBpp0083345; FBgn0038818 [Q8T062-1]
FBtr0334642; FBpp0306704; FBgn0038818 [Q8T062-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
42449

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG4058

UCSC genome browser

More...
UCSCi
CG4058-RA, d. melanogaster [Q8T062-1]
CG4058-RB, d. melanogaster

Keywords - Coding sequence diversityi

Alternative initiation

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014297 Genomic DNA Translation: AAG22165.3
AE014297 Genomic DNA Translation: AAN14361.2
AE014297 Genomic DNA Translation: AGB96153.1
AY069535 mRNA Translation: AAL39680.1
BT099713 mRNA Translation: ACV53077.1
RefSeqiNP_001262773.1, NM_001275844.1 [Q8T062-2]
NP_650904.3, NM_142647.3 [Q8T062-1]
NP_732540.2, NM_169912.1 [Q8T062-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi7227.FBpp0083345

Protein family/group databases

MEROPSiM13.014

Proteomic databases

PaxDbiQ8T062
PRIDEiQ8T062

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
42449

Genome annotation databases

EnsemblMetazoaiFBtr0083936; FBpp0083344; FBgn0038818 [Q8T062-2]
FBtr0083937; FBpp0083345; FBgn0038818 [Q8T062-1]
FBtr0334642; FBpp0306704; FBgn0038818 [Q8T062-2]
GeneIDi42449
KEGGidme:Dmel_CG4058
UCSCiCG4058-RA, d. melanogaster [Q8T062-1]
CG4058-RB, d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
42449
FlyBaseiFBgn0038818, Nep4
VEuPathDBiVectorBase:FBgn0038818

Phylogenomic databases

eggNOGiKOG3624, Eukaryota
GeneTreeiENSGT00940000171376
InParanoidiQ8T062
OMAiDGNLHRW
PhylomeDBiQ8T062

Enzyme and pathway databases

BRENDAi3.4.24.11, 1994

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
42449, 0 hits in 3 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
42449

Protein Ontology

More...
PROi
PR:Q8T062

Gene expression databases

BgeeiFBgn0038818, Expressed in seminal fluid secreting gland and 31 other tissues

Family and domain databases

CDDicd08662, M13, 1 hit
Gene3Di1.10.1380.10, 1 hit
3.40.390.10, 2 hits
InterProiView protein in InterPro
IPR024079, MetalloPept_cat_dom_sf
IPR000718, Peptidase_M13
IPR018497, Peptidase_M13_C
IPR042089, Peptidase_M13_dom_2
IPR008753, Peptidase_M13_N
PANTHERiPTHR11733, PTHR11733, 1 hit
PfamiView protein in Pfam
PF01431, Peptidase_M13, 1 hit
PF05649, Peptidase_M13_N, 1 hit
PRINTSiPR00786, NEPRILYSIN
PROSITEiView protein in PROSITE
PS51885, NEPRILYSIN, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNEP4_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8T062
Secondary accession number(s): Q9I7I4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2017
Last sequence update: June 1, 2002
Last modified: September 29, 2021
This is version 154 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again