Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q8R550 (SH3K1_MOUSE)

Entry version 169 (29 Sep 2021)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

SH3 domain-containing kinase-binding protein 1

Gene

Sh3kbp1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through an association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may be inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit (By similarity).

May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration (By similarity).

Has an essential role in the stimulation of B cell activation (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Endocytosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-182971, EGFR downregulation
R-MMU-6807004, Negative regulation of MET activity
R-MMU-8856825, Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828, Clathrin-mediated endocytosis
R-MMU-8866376, Reelin signalling pathway
R-MMU-983695, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SH3 domain-containing kinase-binding protein 1
Alternative name(s):
Regulator of ubiquitous kinase
Short name:
Ruk
SH3-containing, expressed in tumorigenic astrocytes
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sh3kbp1
Synonyms:Ruk, Seta
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1889583, Sh3kbp1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000040990

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Synapse, Synaptosome

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000977291 – 709SH3 domain-containing kinase-binding protein 1Add BLAST709

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei156PhosphoserineCombined sources1
Modified residuei159PhosphoserineCombined sources1
Modified residuei227PhosphoserineBy similarity1
Modified residuei274PhosphoserineCombined sources1
Modified residuei298PhosphothreonineBy similarity1
Modified residuei480PhosphoserineCombined sources1
Modified residuei553PhosphoserineCombined sources1
Modified residuei555PhosphoserineCombined sources1
Modified residuei565PhosphoserineCombined sources1
Modified residuei631PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Monoubiquitinated by CBL and CBLB after EGF stimulation; probably on its C-terminus.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8R550

PeptideAtlas

More...PeptideAtlasi		Q8R550

PRoteomics IDEntifications database

More...PRIDEi		Q8R550

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		261024 [Q8R550-1]
261025 [Q8R550-2]
261026 [Q8R550-3]
261027 [Q8R550-4]
261028 [Q8R550-5]
261029 [Q8R550-6]
261030 [Q8R550-7]
261031 [Q8R550-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8R550

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8R550

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000040990, Expressed in cardiac ventricle and 295 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8R550, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8R550, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can self-associate and form homotetramers.

Interacts with CD2, F-actin capping protein, PIK3R3, GRB2, EGFR, MET, BLNK, MAP3K4, PDCD6IP, SPRY2, ARHGAP17, ARHGAP27, CRK, BCAR1, SOS1, ASAP1, ARAP3, HIP1R, SYNJ2, INPP5D and STAP1 (By similarity).

Interacts with CBL (PubMed:21830225).

Interacts with CBLB, but does not interact with CBLC. Two molecules of SH3KBP1 seem to bind through their respective SH3 1 domain to one molecule of CBLB. The interaction with CBL or CBLB and EGFR is increased upon EGF stimulation. The interaction with CBL is attenuated by PDCD6IP.

Interacts through its proline-rich region with the SH3 domain of endophilins SH3GL1, SH3GL2 and SH3GL3. The SH3KBP1-endophilin complex seems to associate with a complex containing the phosphorylated receptor (EGFR or MET) and phosphorylated CBL. Probably associates with ASAP1 and phosphorylated EGFR. Probably part of a complex consisting of at least SH3KBP1, ASAP1 and ARAP3.

Interacts with focal adhesion kinases PTK2/FAK1 AND PTK2B/PYK2, probably as a dimer.

Interacts with DAB2 and probably associates with chathrin through its interaction with DAB2.

Part of a complex consisting of SH3KBP1, DAB2, and clathrin heavy chain. DAB2 and clathrin dissociate from SH3KBP1 following growth factor treatment, enabling interaction with CBL.

Interacts with DDN and probably associates with MAGI2 through its interaction with DDN.

Interacts with the SH3 domains of SRC tyrosine-protein kinases SRC, LCK, LYN, FGR, FYN and HCK.

Interacts with TRADD, BIRC2, TRAF1, TRAF2 and TNFR1, and the association with a TNFR1-associated complex upon stimulation with TNF-alpha seems to be mediated by SRC. Probably part of a complex consisting of at least SH3KBP1, ASAP1 and ARAP3 (By similarity).

Interacts (via SH3 domains) with SHKBP1 (via PXXXPR motifs) (PubMed:11152963, PubMed:21830225).

Interacts with ATX2 (PubMed:18602463). Interaction with CBL is abolished in the presence of SHKBP1 (PubMed:21830225).

Interacts (via SH3 domains) with ZFP36 (via extreme C-terminal region).

Interacts with MAP3K4; this interaction enhances the association with ZFP36 (By similarity).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		208383, 38 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8R550

Protein interaction database and analysis system

More...IntActi		Q8R550, 12 interactors

Molecular INTeraction database

More...MINTi		Q8R550

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000108075

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8R550, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1709
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8R550

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q8R550

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 58SH3 1PROSITE-ProRule annotationAdd BLAST58
Domaini98 – 157SH3 2PROSITE-ProRule annotationAdd BLAST60
Domaini311 – 372SH3 3PROSITE-ProRule annotationAdd BLAST62

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni221 – 242DisorderedSequence analysisAdd BLAST22
Regioni289 – 309DisorderedSequence analysisAdd BLAST21
Regioni372 – 485DisorderedSequence analysisAdd BLAST114
Regioni511 – 650DisorderedSequence analysisAdd BLAST140

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili646 – 708Sequence analysisAdd BLAST63

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi222 – 242Polar residuesSequence analysisAdd BLAST21
Compositional biasi397 – 434Basic and acidic residuesSequence analysisAdd BLAST38
Compositional biasi514 – 551Polar residuesSequence analysisAdd BLAST38
Compositional biasi553 – 575Basic and acidic residuesSequence analysisAdd BLAST23
Compositional biasi576 – 594Polar residuesSequence analysisAdd BLAST19
Compositional biasi604 – 637Polar residuesSequence analysisAdd BLAST34

Keywords - Domaini

Coiled coil, Repeat, SH3 domain, SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4348, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155886

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_024255_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8R550

Identification of Orthologs from Complete Genome Data

More...OMAi		WWEGELA

Database of Orthologous Groups

More...OrthoDBi		1577081at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8R550

TreeFam database of animal gene trees

More...TreeFami		TF350191

Family and domain databases

Conserved Domains Database

More...CDDi		cd12052, SH3_CIN85_1, 1 hit
cd12055, SH3_CIN85_2, 1 hit
cd12057, SH3_CIN85_3, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035770, CIN85_SH3_1
IPR035771, CIN85_SH3_2
IPR035772, CIN85_SH3_3
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR028506, Sorbin_SH3

The PANTHER Classification System

More...PANTHERi		PTHR14167:SF6, PTHR14167:SF6, 2 hits

Pfam protein domain database

More...Pfami		View protein in Pfam
PF14604, SH3_9, 3 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00452, SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00326, SH3, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50044, SSF50044, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50002, SH3, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8R550-1) [UniParc]FASTAAdd to basket
Also known as: Ruk-xl

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVEAIVEFDY QAQHDDELTI SVGEVITNIR KEDGGWWEGQ INGRRGLFPD 
        60         70         80         90        100
NFVREIKKDM KKDLLSNKAP EKPMHDVSSG NALLSSETIL RTNKRGERRR 
       110        120        130        140        150
RRCQVAFSYL PQNDDELELK VGDIIEVVGE VEEGWWEGVL NGKTGMFPSN 
       160        170        180        190        200
FIKELSGESD ELGISQDEQL SKSRPEGFLP ASLLPFPAHG AKGKTTFEGT 
       210        220        230        240        250
ILYRAAPGKT EGHRRYYSLR ETTGSESDGG DSSSTKSEGA NGTMATAAIQ 
       260        270        280        290        300
PKKVKGVGFG DIFKDKPIKL RPRSIEVEND FLPVEKTIGK KLPPATSTPD 
       310        320        330        340        350
PSKTEMDSRT KTKDYCKVIF PYEAQNDDEL TIKEGDIVTL INKDCIDVGW 
       360        370        380        390        400
WEGELNGRRG VFPDNFVKLL PSDFDKEGNR PKKPPPPSAP VVKQGAGTTE 
       410        420        430        440        450
RKHEIKKIPP ERPETLPNRT EEKERPEREP KLDLQKPSVP AIPPKKPRPP 
       460        470        480        490        500
KTNSLNRPGA LPPRRPERPV GPLTHTRGDS PKIDLAGSAL SGILDKDLSD 
       510        520        530        540        550
RSNDIDLEGF DSVISSTEKL SHPTTSRPKA TGRRPPSQSL TSSSLSSPDI 
       560        570        580        590        600
FDSPSPEEDK EEHISLAHRG IDVSKKTSKT VTISQVSDNK TSLPPKPGTM 
       610        620        630        640        650
AAASSGPASL SSVASSPMSS SLGTAGQRAS SPSLFSTEGK PKMEPAVSSQ 
       660        670        680        690        700
AAIEELKMQV RELRTIIETM KDQQKREIKQ LLSELDEEKK IRLRLQMEVN 

DIKKALQSK
Length:709
Mass (Da):78,170
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAC2DDFB3248A458B
GO
Isoform 2 (identifier: Q8R550-2) [UniParc]FASTAAdd to basket
Also known as: Ruk-l

The sequence of this isoform differs from the canonical sequence as follows:
     174-217: Missing.

Show »
Length:665
Mass (Da):73,328
Checksum:i724607807A66B043
GO
Isoform 3 (identifier: Q8R550-3) [UniParc]FASTAAdd to basket
Also known as: Ruk-deltaA

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVR → MELSAAKAPSPTDLPES
     174-217: Missing.

Show »
Length:628
Mass (Da):68,820
Checksum:i1C4AEC6BE48D5D17
GO
Isoform 4 (identifier: Q8R550-4) [UniParc]FASTAAdd to basket
Also known as: Ruk-m1

The sequence of this isoform differs from the canonical sequence as follows:
     1-286: MVEAIVEFDY...VENDFLPVEK → MGEEVSLGEK...FGVFLVNEET

Show »
Length:464
Mass (Da):50,755
Checksum:i54F018C499D51044
GO
Isoform 5 (identifier: Q8R550-5) [UniParc]FASTAAdd to basket
Also known as: Ruk-m3

The sequence of this isoform differs from the canonical sequence as follows:
     1-286: MVEAIVEFDY...VENDFLPVEK → MGEE

Show »
Length:427
Mass (Da):46,827
Checksum:i460A56431A4FDDCD
GO
Isoform 6 (identifier: Q8R550-6) [UniParc]FASTAAdd to basket
Also known as: Ruk-t

The sequence of this isoform differs from the canonical sequence as follows:
     1-477: MVEAIVEFDY...RPVGPLTHTR → MFPFRKGARPPSMNLFRQTCW

Show »
Length:253
Mass (Da):27,442
Checksum:iD1B221FDDE4C72C7
GO
Isoform 7 (identifier: Q8R550-7) [UniParc]FASTAAdd to basket
Also known as: Ruk-h

The sequence of this isoform differs from the canonical sequence as follows:
     1-599: Missing.

Show »
Length:110
Mass (Da):11,992
Checksum:i6536493B3B3761DE
GO
Isoform 8 (identifier: Q8R550-8) [UniParc]FASTAAdd to basket
Also known as: Ruk-deltaCP

The sequence of this isoform differs from the canonical sequence as follows:
     174-217: Missing.
     320-630: Missing.

Show »
Length:354
Mass (Da):39,765
Checksum:iB580135B37F9B571
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q0C1E9Q0C1_MOUSE
SH3 domain-containing kinase-bindin...
Sh3kbp1
447Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AZ85B1AZ85_MOUSE
SH3 domain-containing kinase-bindin...
Sh3kbp1
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0R0Y8B0R0Y8_MOUSE
SH3 domain-containing kinase-bindin...
Sh3kbp1
209Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti251 – 259PKKVKGVGF → NDDELTIKE (Ref. 5) Curated9
Sequence conflicti478 – 528GDSPK…TTSRP → YCHVLTKAGGHGMIMKIGEG MRTKLCLKIPATFFSSEKVV ARCWGATWCRL in BAC30033 (PubMed:16141072).CuratedAdd BLAST51
Sequence conflicti529 – 709Missing in BAC30033 (PubMed:16141072).CuratedAdd BLAST181

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0075091 – 599Missing in isoform 7. CuratedAdd BLAST599
Alternative sequenceiVSP_0075081 – 477MVEAI…LTHTR → MFPFRKGARPPSMNLFRQTC W in isoform 6. CuratedAdd BLAST477
Alternative sequenceiVSP_0075071 – 286MVEAI…LPVEK → MGEEVSLGEKNISPEQASCG ALHPRGWGSQTFGVFLVNEE T in isoform 4. CuratedAdd BLAST286
Alternative sequenceiVSP_0075061 – 286MVEAI…LPVEK → MGEE in isoform 5. CuratedAdd BLAST286
Alternative sequenceiVSP_0075051 – 54MVEAI…DNFVR → MELSAAKAPSPTDLPES in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_007510174 – 217Missing in isoform 2, isoform 3 and isoform 8. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_007511320 – 630Missing in isoform 8. 1 PublicationAdd BLAST311

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF472327 AF472326 Genomic DNA Translation: AAL82456.1
AF472327, AF472325, AF472326 Genomic DNA Translation: AAL82457.1
AF472327 AF472326 Genomic DNA Translation: AAL82458.1
AF472327 AF472326 Genomic DNA Translation: AAL82459.1
AF472327 AF472326 Genomic DNA Translation: AAL82460.1
AF472327 AF472326 Genomic DNA Translation: AAL82461.1
AF472327 AF472326 Genomic DNA Translation: AAL82462.1
AK004636 mRNA Translation: BAB23427.2
AK020782 mRNA Translation: BAB32209.2
AK038540 mRNA Translation: BAC30033.1
AK049182 mRNA Translation: BAC33592.1
AL929452 Genomic DNA No translation available.
AF243508 Genomic DNA Translation: AAF68439.1
AI428677 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS41194.1 [Q8R550-3]
CCDS53234.1 [Q8R550-2]
CCDS53235.1 [Q8R550-5]

NCBI Reference Sequences

More...RefSeqi		NP_001129199.1, NM_001135727.2 [Q8R550-2]
NP_001129200.1, NM_001135728.2 [Q8R550-5]
NP_001277590.1, NM_001290661.1 [Q8R550-7]
NP_001277593.1, NM_001290664.1 [Q8R550-7]
NP_067364.2, NM_021389.6 [Q8R550-3]
XP_006528987.1, XM_006528924.3 [Q8R550-1]
XP_011246151.1, XM_011247849.2
XP_011246153.1, XM_011247851.2 [Q8R550-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000073094; ENSMUSP00000072840; ENSMUSG00000040990 [Q8R550-1]
ENSMUST00000080394; ENSMUSP00000079257; ENSMUSG00000040990 [Q8R550-3]
ENSMUST00000112451; ENSMUSP00000108070; ENSMUSG00000040990 [Q8R550-5]
ENSMUST00000112453; ENSMUSP00000108072; ENSMUSG00000040990 [Q8R550-4]
ENSMUST00000112456; ENSMUSP00000108075; ENSMUSG00000040990 [Q8R550-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		58194

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:58194

UCSC genome browser

More...UCSCi		uc009uss.3, mouse [Q8R550-1]
uc009usv.3, mouse [Q8R550-3]
uc009usx.3, mouse [Q8R550-5]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF472327 AF472326 Genomic DNA Translation: AAL82456.1
AF472327, AF472325, AF472326 Genomic DNA Translation: AAL82457.1
AF472327 AF472326 Genomic DNA Translation: AAL82458.1
AF472327 AF472326 Genomic DNA Translation: AAL82459.1
AF472327 AF472326 Genomic DNA Translation: AAL82460.1
AF472327 AF472326 Genomic DNA Translation: AAL82461.1
AF472327 AF472326 Genomic DNA Translation: AAL82462.1
AK004636 mRNA Translation: BAB23427.2
AK020782 mRNA Translation: BAB32209.2
AK038540 mRNA Translation: BAC30033.1
AK049182 mRNA Translation: BAC33592.1
AL929452 Genomic DNA No translation available.
AF243508 Genomic DNA Translation: AAF68439.1
AI428677 mRNA No translation available.
CCDSiCCDS41194.1 [Q8R550-3]
CCDS53234.1 [Q8R550-2]
CCDS53235.1 [Q8R550-5]
RefSeqiNP_001129199.1, NM_001135727.2 [Q8R550-2]
NP_001129200.1, NM_001135728.2 [Q8R550-5]
NP_001277590.1, NM_001290661.1 [Q8R550-7]
NP_001277593.1, NM_001290664.1 [Q8R550-7]
NP_067364.2, NM_021389.6 [Q8R550-3]
XP_006528987.1, XM_006528924.3 [Q8R550-1]
XP_011246151.1, XM_011247849.2
XP_011246153.1, XM_011247851.2 [Q8R550-6]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WI7NMR-A101-155[»]
2DA9NMR-A314-370[»]
5XHZX-ray1.32A/B98-157[»]
SMRiQ8R550
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi208383, 38 interactors
CORUMiQ8R550
IntActiQ8R550, 12 interactors
MINTiQ8R550
STRINGi10090.ENSMUSP00000108075

PTM databases

iPTMnetiQ8R550
PhosphoSitePlusiQ8R550

Proteomic databases

jPOSTiQ8R550
PeptideAtlasiQ8R550
PRIDEiQ8R550
ProteomicsDBi261024 [Q8R550-1]
261025 [Q8R550-2]
261026 [Q8R550-3]
261027 [Q8R550-4]
261028 [Q8R550-5]
261029 [Q8R550-6]
261030 [Q8R550-7]
261031 [Q8R550-8]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		521, 211 antibodies

The DNASU plasmid repository

More...DNASUi		58194

Genome annotation databases

EnsembliENSMUST00000073094; ENSMUSP00000072840; ENSMUSG00000040990 [Q8R550-1]
ENSMUST00000080394; ENSMUSP00000079257; ENSMUSG00000040990 [Q8R550-3]
ENSMUST00000112451; ENSMUSP00000108070; ENSMUSG00000040990 [Q8R550-5]
ENSMUST00000112453; ENSMUSP00000108072; ENSMUSG00000040990 [Q8R550-4]
ENSMUST00000112456; ENSMUSP00000108075; ENSMUSG00000040990 [Q8R550-2]
GeneIDi58194
KEGGimmu:58194
UCSCiuc009uss.3, mouse [Q8R550-1]
uc009usv.3, mouse [Q8R550-3]
uc009usx.3, mouse [Q8R550-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		30011
MGIiMGI:1889583, Sh3kbp1
VEuPathDBiHostDB:ENSMUSG00000040990

Phylogenomic databases

eggNOGiKOG4348, Eukaryota
GeneTreeiENSGT00940000155886
HOGENOMiCLU_024255_1_0_1
InParanoidiQ8R550
OMAiWWEGELA
OrthoDBi1577081at2759
PhylomeDBiQ8R550
TreeFamiTF350191

Enzyme and pathway databases

ReactomeiR-MMU-182971, EGFR downregulation
R-MMU-6807004, Negative regulation of MET activity
R-MMU-8856825, Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828, Clathrin-mediated endocytosis
R-MMU-8866376, Reelin signalling pathway
R-MMU-983695, Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		58194, 2 hits in 64 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Sh3kbp1, mouse
EvolutionaryTraceiQ8R550

Protein Ontology

More...PROi		PR:Q8R550
RNActiQ8R550, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000040990, Expressed in cardiac ventricle and 295 other tissues
ExpressionAtlasiQ8R550, baseline and differential
GenevisibleiQ8R550, MM

Family and domain databases

CDDicd12052, SH3_CIN85_1, 1 hit
cd12055, SH3_CIN85_2, 1 hit
cd12057, SH3_CIN85_3, 1 hit
InterProiView protein in InterPro
IPR035770, CIN85_SH3_1
IPR035771, CIN85_SH3_2
IPR035772, CIN85_SH3_3
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR028506, Sorbin_SH3
PANTHERiPTHR14167:SF6, PTHR14167:SF6, 2 hits
PfamiView protein in Pfam
PF14604, SH3_9, 3 hits
PRINTSiPR00452, SH3DOMAIN
SMARTiView protein in SMART
SM00326, SH3, 3 hits
SUPFAMiSSF50044, SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50002, SH3, 3 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSH3K1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8R550
Secondary accession number(s): B1AZ86
, B1AZ87, Q8CAL8, Q8CEF6, Q8R545, Q8R546, Q8R547, Q8R548, Q8R549, Q8R551, Q9CTQ9, Q9DC14, Q9JKC3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 23, 2003
Last sequence update: June 1, 2002
Last modified: September 29, 2021
This is version 169 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again