Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (16 Oct 2019)
Sequence version 2 (07 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Pappalysin-1

Gene

Pappa

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metalloproteinase which specifically cleaves IGFBP-4 and IGFBP-5, resulting in release of bound IGF. Cleavage of IGFBP-4 is dramatically enhanced by the presence of IGF, whereas cleavage of IGFBP-5 is slightly inhibited by the presence of IGF. Isoform 2 cleaves IGFBP-4 very slowly compared to PAPP-A, but its ability to cleave IGFBP-5 is unaffected.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Cleavage of the 135-Met-|-Lys-136 bond in insulin-like growth factor binding protein (IGFBP)-4, and the 143-Ser-|-Lys-144 bond in IGFBP-5. EC:3.4.24.79

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi559Zinc; catalyticPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei560PROSITE-ProRule annotation1
Metal bindingi563Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi569Zinc; catalyticPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M43.004

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pappalysin-1 (EC:3.4.24.79)
Alternative name(s):
Insulin-like growth factor-dependent IGF-binding protein 4 protease
Short name:
IGF-dependent IGFBP-4 protease
Short name:
IGFBP-4ase
Pregnancy-associated plasma protein A
Short name:
PAPP-A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pappa
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:97479 Pappa

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002924723 – 81By similarityAdd BLAST59
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002924882 – 1624Pappalysin-1Add BLAST1543

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi141 ↔ 232PROSITE-ProRule annotation
Disulfide bondi324 ↔ 619PROSITE-ProRule annotation
Disulfide bondi329 ↔ 654PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi387N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi398N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi411 ↔ 425PROSITE-ProRule annotation
Disulfide bondi421 ↔ 437PROSITE-ProRule annotation
Glycosylationi426N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi454 ↔ 470PROSITE-ProRule annotation
Disulfide bondi458Interchain (with C-49 in PRG2 proform)PROSITE-ProRule annotation
Disulfide bondi471 ↔ 482PROSITE-ProRule annotation
Glycosylationi516N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi580 ↔ 597Or C-580 with C-609PROSITE-ProRule annotation
Disulfide bondi584 ↔ 609Or C-584 with C-597PROSITE-ProRule annotation
Glycosylationi598N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi616N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi707 ↔ 875PROSITE-ProRule annotation
Disulfide bondi710 ↔ 878PROSITE-ProRule annotation
Glycosylationi722N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi729Interchain (with C-170 in PRG2 proform)PROSITE-ProRule annotation
Disulfide bondi750 ↔ 832PROSITE-ProRule annotation
Disulfide bondi772 ↔ 778PROSITE-ProRule annotation
Glycosylationi822N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi944 ↔ 972PROSITE-ProRule annotation
Disulfide bondi957 ↔ 968PROSITE-ProRule annotation
Disulfide bondi980 ↔ 987PROSITE-ProRule annotation
Disulfide bondi996 ↔ 1008PROSITE-ProRule annotation
Glycosylationi1023N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1033 ↔ 1067PROSITE-ProRule annotation
Disulfide bondi1048 ↔ 1136PROSITE-ProRule annotation
Disulfide bondi1189 ↔ 1202PROSITE-ProRule annotation
Disulfide bondi1207InterchainPROSITE-ProRule annotation
Disulfide bondi1212 ↔ 1266PROSITE-ProRule annotation
Glycosylationi1219N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1223N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1224 ↔ 1235PROSITE-ProRule annotation
Disulfide bondi1239 ↔ 1277PROSITE-ProRule annotation
Disulfide bondi1282 ↔ 1326PROSITE-ProRule annotation
Disulfide bondi1297 ↔ 1307PROSITE-ProRule annotation
Disulfide bondi1311 ↔ 1339PROSITE-ProRule annotation
Glycosylationi1320N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1343 ↔ 1396PROSITE-ProRule annotation
Disulfide bondi1359 ↔ 1370PROSITE-ProRule annotation
Disulfide bondi1374 ↔ 1407PROSITE-ProRule annotation
Disulfide bondi1412 ↔ 1455PROSITE-ProRule annotation
Disulfide bondi1425 ↔ 1435PROSITE-ProRule annotation
Disulfide bondi1439 ↔ 1468PROSITE-ProRule annotation
Disulfide bondi1475 ↔ 1536PROSITE-ProRule annotation
Disulfide bondi1489 ↔ 1499PROSITE-ProRule annotation
Disulfide bondi1503 ↔ 1551PROSITE-ProRule annotation
Glycosylationi1516N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1555 ↔ 1573PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
non-CPTAC-3337

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8R4K8

PeptideAtlas

More...
PeptideAtlasi
Q8R4K8

PRoteomics IDEntifications database

More...
PRIDEi
Q8R4K8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8R4K8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8R4K8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in kidney, spleen, brain, ovary, breast, skin, prostate, uterus, and placenta.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028370 Expressed in 194 organ(s), highest expression level in stroma of bone marrow

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8R4K8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked. In pregnancy serum, predominantly found as a disulfide-linked 2:2 heterotetramer with the proform of PRG2 (By similarity).

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000081545

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8R4K8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1210 – 1279Sushi 1PROSITE-ProRule annotationAdd BLAST70
Domaini1280 – 1341Sushi 2PROSITE-ProRule annotationAdd BLAST62
Domaini1342 – 1409Sushi 3PROSITE-ProRule annotationAdd BLAST68
Domaini1410 – 1470Sushi 4PROSITE-ProRule annotationAdd BLAST61
Domaini1473 – 1553Sushi 5PROSITE-ProRule annotationAdd BLAST81

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni272 – 583MetalloproteaseAdd BLAST312

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi24 – 82Arg-richAdd BLAST59

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M43B family.Curated

Keywords - Domaini

Repeat, Signal, Sushi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410KDUG Eukaryota
ENOG410YRGU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156654

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8R4K8

KEGG Orthology (KO)

More...
KOi
K07762

Identification of Orthologs from Complete Genome Data

More...
OMAi
QCPGWVV

Database of Orthologous Groups

More...
OrthoDBi
105200at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8R4K8

TreeFam database of animal gene trees

More...
TreeFami
TF331636

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00033 CCP, 4 hits
cd04275 ZnMc_pappalysin_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR006558 LamG-like
IPR024079 MetalloPept_cat_dom_sf
IPR011936 Myxo_disulph_rpt
IPR000800 Notch_dom
IPR030433 PAPPA
IPR008754 Peptidase_M43
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom

The PANTHER Classification System

More...
PANTHERi
PTHR46130:SF2 PTHR46130:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05572 Peptidase_M43, 1 hit
PF00084 Sushi, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00032 CCP, 4 hits
SM00560 LamGL, 1 hit
SM00004 NL, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 1 hit
SSF57535 SSF57535, 4 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02232 myxo_disulf_rpt, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50923 SUSHI, 5 hits
PS00142 ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8R4K8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRLWSWVLRL GLLSAALGCG LAERPRRVRR DPRAVRPPRP AAGPATCATR
60 70 80 90 100
AARGRRASPP PPPGGAWEAV RVPRRRQQRA ARGAEEPSPP SRALYFSGRG
110 120 130 140 150
EQLRLRADLE LPRDAFTLQV WLRAEGGQKS PAVITGLYDK CSYTSRDRGW
160 170 180 190 200
VMGIHTTSDQ GNRDPRYFFS LKTDRARKVT TIDAHRSYLP GQWVHLAATY
210 220 230 240 250
DGRLMKLYMN GAQVATSAEQ VGGIFSPLTQ KCKVLMLGGS ALNHNFRGHI
260 270 280 290 300
EHFSLWKVAR TQREIVSDME TRGLHTPLPQ LLLQENWDNV KRTWSPMKDG
310 320 330 340 350
NSPQVEFSNA HGFLLDTNLE PPLCGQTLCD NTEVISSYNQ LPSFRQPKVV
360 370 380 390 400
RYRVVNIYDD HHENPTVSWQ QIDFQHQQLA EAFQHYNISW ELEVLNINSS
410 420 430 440 450
SLRHRLILAN CDISKIGDEK CDPECNHTLT GHDGGDCRQL RYPAFMKKQQ
460 470 480 490 500
NGVCDMDCNY ERFNFDGGEC CDPDITDVTK TCFDPDSPHR AYLDVNELKN
510 520 530 540 550
ILRLDGSTHL NIFFANSSEE ELAGVATWPW DKEALMHLGG IVLNPSFYGI
560 570 580 590 600
PGHTHTMIHE IGHSLGLYHI FRGISEIQSC SDPCMETEPS FETGDLCNDT
610 620 630 640 650
NPAPKHKFCG DPGPGNDTCG FHGFFNTPYN NFMSYADDDC TDSFTPNQVS
660 670 680 690 700
RMHCYLDLVY QSWQPSRKPA PVALAPQVVG HTMDSVMLEW FPPIDGHFFE
710 720 730 740 750
RELGSACDLC LEGRILVQYA FNASSPMPCG PSGHWSPREA EGHPDVEQPC
760 770 780 790 800
KSSVRTWSPN SAVNPHTVPP ACPEPQGCYL ELEFRYPLVP ESLTIWVTFV
810 820 830 840 850
SSDWDSSGAV NDIKLLTISG KNISLGPQNV FCDIPLTIRL RDVGEEVYGI
860 870 880 890 900
QIYTLDEHLE IDAAMLTSTV DSPLCLQCKP LQYKVLRDPP LLEDVASLLH
910 920 930 940 950
LNRRFMDTDL KLGSVYQYRI ITISGNEESE PSPAAIYTHG SGYCGDGVIQ
960 970 980 990 1000
KDQGEECDDM NKVNGDGCSL FCKQEVSFNC IDEPSRCYFH DGDGMCEEFE
1010 1020 1030 1040 1050
QKTSIKDCGV YTPQGFLDQW ASNASVSHQD QQCPGWVVIG QPAASQVCRT
1060 1070 1080 1090 1100
KVIDLSEGIS QHAWYPCTIT YPYYHLPQTT FWLQTYFSQP MVAAAVIIHL
1110 1120 1130 1140 1150
VTDGTYYGDQ KQETISVQLL DTKDQSHDLG LHVLSCRNNP LIIPVVHDLS
1160 1170 1180 1190 1200
QPFYHSQAVH VSFSSPLVAI SGVALRSFDN FDPVTLSSCQ RGETYSPAEQ
1210 1220 1230 1240 1250
SCVHFACQAA DCPELAVGNA SLNCSSNHHY HGAQCTVSCQ TGYVLQIQRD
1260 1270 1280 1290 1300
DELIKSQVGP SITVTCTEGK WNKQVACEPV DCGIPDHHHV YAASFSCPEG
1310 1320 1330 1340 1350
TTFGRRCSFQ CRHPAQLKGN NSFLTCMEDG LWSFPEALCE LMCLAPPPVP
1360 1370 1380 1390 1400
NADLQTARCR ENKHKVGSFC KYKCKPGYHV PGSSRKSKKR AFKTQCTQDG
1410 1420 1430 1440 1450
SWQEGTCVPV TCDPPPPKFH GLYQCTNGFQ FNSECRIKCE DSDASQGRGS
1460 1470 1480 1490 1500
NIIHCRKDGT WSGSFHVCRE MQGQCSAPNQ LNSNLKLQCP DGYAIGSECA
1510 1520 1530 1540 1550
ISCLDHNSES IILPVNLTVR DIPHWMNPTR VQRIVCTAGL QWYPHPALIH
1560 1570 1580 1590 1600
CVKGCEPFMG DNYCDAINNR AFCNYDGGDC CTSTVKTKKV TPFPMSCDLQ
1610 1620
NDCACRDPEA QEHNRKDLRG YSHG
Length:1,624
Mass (Da):181,318
Last modified:December 7, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB09404C206CB60D1
GO
Isoform 2 (identifier: Q8R4K8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     490-490: R → RQSIRKRAHVVEESWLPHGKQKAKKRKRTR

Show »
Length:1,653
Mass (Da):184,839
Checksum:iEF7A13AFE698A430
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012193490R → RQSIRKRAHVVEESWLPHGK QKAKKRKRTR in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL691454 Genomic DNA No translation available.
AL691491 Genomic DNA No translation available.
AF439513 mRNA Translation: AAM12687.1
AF439514 mRNA Translation: AAM12688.1
AF510317 Genomic DNA Translation: AAM44048.1
AF258461 mRNA Translation: AAG09799.1
AF260433 mRNA Translation: AAF70319.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18267.1 [Q8R4K8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_067337.1, NM_021362.1 [Q8R4K8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000084501; ENSMUSP00000081545; ENSMUSG00000028370 [Q8R4K8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
18491

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:18491

UCSC genome browser

More...
UCSCi
uc008thm.1 mouse [Q8R4K8-1]
uc012dgb.1 mouse [Q8R4K8-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL691454 Genomic DNA No translation available.
AL691491 Genomic DNA No translation available.
AF439513 mRNA Translation: AAM12687.1
AF439514 mRNA Translation: AAM12688.1
AF510317 Genomic DNA Translation: AAM44048.1
AF258461 mRNA Translation: AAG09799.1
AF260433 mRNA Translation: AAF70319.1
CCDSiCCDS18267.1 [Q8R4K8-1]
RefSeqiNP_067337.1, NM_021362.1 [Q8R4K8-1]

3D structure databases

SMRiQ8R4K8
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000081545

Protein family/group databases

MEROPSiM43.004

PTM databases

iPTMnetiQ8R4K8
PhosphoSitePlusiQ8R4K8

Proteomic databases

CPTACinon-CPTAC-3337
PaxDbiQ8R4K8
PeptideAtlasiQ8R4K8
PRIDEiQ8R4K8

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
18491

Genome annotation databases

EnsembliENSMUST00000084501; ENSMUSP00000081545; ENSMUSG00000028370 [Q8R4K8-1]
GeneIDi18491
KEGGimmu:18491
UCSCiuc008thm.1 mouse [Q8R4K8-1]
uc012dgb.1 mouse [Q8R4K8-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5069
MGIiMGI:97479 Pappa

Phylogenomic databases

eggNOGiENOG410KDUG Eukaryota
ENOG410YRGU LUCA
GeneTreeiENSGT00940000156654
InParanoidiQ8R4K8
KOiK07762
OMAiQCPGWVV
OrthoDBi105200at2759
PhylomeDBiQ8R4K8
TreeFamiTF331636

Enzyme and pathway databases

ReactomeiR-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Pappa mouse

Protein Ontology

More...
PROi
PR:Q8R4K8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028370 Expressed in 194 organ(s), highest expression level in stroma of bone marrow
GenevisibleiQ8R4K8 MM

Family and domain databases

CDDicd00033 CCP, 4 hits
cd04275 ZnMc_pappalysin_like, 1 hit
Gene3Di3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR006558 LamG-like
IPR024079 MetalloPept_cat_dom_sf
IPR011936 Myxo_disulph_rpt
IPR000800 Notch_dom
IPR030433 PAPPA
IPR008754 Peptidase_M43
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom
PANTHERiPTHR46130:SF2 PTHR46130:SF2, 1 hit
PfamiView protein in Pfam
PF05572 Peptidase_M43, 1 hit
PF00084 Sushi, 3 hits
SMARTiView protein in SMART
SM00032 CCP, 4 hits
SM00560 LamGL, 1 hit
SM00004 NL, 3 hits
SUPFAMiSSF49899 SSF49899, 1 hit
SSF57535 SSF57535, 4 hits
TIGRFAMsiTIGR02232 myxo_disulf_rpt, 1 hit
PROSITEiView protein in PROSITE
PS50923 SUSHI, 5 hits
PS00142 ZINC_PROTEASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPAPP1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8R4K8
Secondary accession number(s): Q80VW3
, Q80YY1, Q8K423, Q8R4K7, Q9ES06, Q9JK57
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: October 16, 2019
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again