Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (02 Jun 2021)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Probable RNA-binding protein 19

Gene

Rbm19

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in embryo pre-implantation development.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • RNA binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, RNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable RNA-binding protein 19
Alternative name(s):
RNA-binding motif protein 19
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rbm19
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1921361, Rbm19

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Arrests embryonic development prior to implantation. Embryos at 3.5 dpc lack the mature, tripartite nucleoli, but instead, contain spheres resembling nucleolar precursor body (NPB), indicating arrest of nucleologenesis.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000817821 – 952Probable RNA-binding protein 19Add BLAST952

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei177PhosphoserineBy similarity1
Modified residuei179PhosphoserineBy similarity1
Modified residuei183PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki479Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei693PhosphoserineCombined sources1
Modified residuei928PhosphoserineBy similarity1
Modified residuei944PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8R3C6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8R3C6

PeptideAtlas

More...
PeptideAtlasi
Q8R3C6

PRoteomics IDEntifications database

More...
PRIDEi
Q8R3C6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
255121 [Q8R3C6-1]
255122 [Q8R3C6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8R3C6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8R3C6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the crypts of Lieberkuhn of the intestine (at protein level).1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed during early development. Expressed in the epithelium of the embryonic gut tube (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000029594, Expressed in dorsal pancreas and 258 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8R3C6, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
216500, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q8R3C6, 1 interactor

Molecular INTeraction database

More...
MINTi
Q8R3C6

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000031590

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8R3C6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1952
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8R3C6

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8R3C6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2 – 79RRM 1PROSITE-ProRule annotationAdd BLAST78
Domaini293 – 368RRM 2PROSITE-ProRule annotationAdd BLAST76
Domaini400 – 478RRM 3PROSITE-ProRule annotationAdd BLAST79
Domaini584 – 656RRM 4PROSITE-ProRule annotationAdd BLAST73
Domaini722 – 803RRM 5PROSITE-ProRule annotationAdd BLAST82
Domaini824 – 904RRM 6PROSITE-ProRule annotationAdd BLAST81

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni85 – 126DisorderedSequence analysisAdd BLAST42
Regioni159 – 267DisorderedSequence analysisAdd BLAST109
Regioni367 – 395DisorderedSequence analysisAdd BLAST29
Regioni481 – 504DisorderedSequence analysisAdd BLAST24
Regioni664 – 719DisorderedSequence analysisAdd BLAST56

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi90 – 106Polar residuesSequence analysisAdd BLAST17
Compositional biasi107 – 126Basic and acidic residuesSequence analysisAdd BLAST20
Compositional biasi178 – 192Acidic residuesSequence analysisAdd BLAST15
Compositional biasi208 – 224Basic and acidic residuesSequence analysisAdd BLAST17
Compositional biasi225 – 250Acidic residuesSequence analysisAdd BLAST26
Compositional biasi668 – 693Basic and acidic residuesSequence analysisAdd BLAST26
Compositional biasi702 – 719Acidic residuesSequence analysisAdd BLAST18

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RRM MRD1 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0110, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00840000129953

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_008479_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8R3C6

Database of Orthologous Groups

More...
OrthoDBi
1428854at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8R3C6

TreeFam database of animal gene trees

More...
TreeFami
TF105725

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12564, RRM1_RBM19, 1 hit
cd12502, RRM2_RMB19, 1 hit
cd12567, RRM3_RBM19, 1 hit
cd12569, RRM4_RBM19, 1 hit
cd12318, RRM5_RBM19_like, 1 hit
cd12571, RRM6_RBM19, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 6 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR034419, RBM19_RRM3
IPR034420, RBM19_RRM4
IPR034423, RBM19_RRM5
IPR034421, RBM19_RRM6
IPR034418, RMB19_RRM1
IPR034417, RMB19_RRM2
IPR000504, RRM_dom
IPR003954, RRM_dom_euk

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076, RRM_1, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360, RRM, 6 hits
SM00361, RRM_1, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928, SSF54928, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102, RRM, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8R3C6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRLIVKNLP NGMKEERFRQ LFAAFGTLTD CSLKFTKDGK FRKFGFIGFK
60 70 80 90 100
SEEEAQAALN HFHRSFIDTT RITVEFCKSF GDPSKPRAWS KHAQKSSQPK
110 120 130 140 150
QPSQDSVPSD TKKDKKKKGP SDLEKLKEDA KFQEFLSIHQ KRTQVATWAN
160 170 180 190 200
DALEAKLPKA KTKASSDYLN FDSDSNSDSG QESEEEPARE DPEEEQGLQP
210 220 230 240 250
KAAVQKELSD MDYLKSKMVR AEVSSEDEDE EDSEDEAVNC EEGSEEEEEE
260 270 280 290 300
GSPASPAKQG GVSRGAVPGV LRPQEAAGKV EKPVSQKEPT TPYTVKLRGA
310 320 330 340 350
PFNVTEKNVI EFLAPLKPVA IRIVRNAHGN KTGYVFVDLS SEEEVKKALK
360 370 380 390 400
CNRDYMGGRY IEVFREKQAP TARGPPKSTT PWQGRTLGEN EEEEDLADSG
410 420 430 440 450
RLFVRNLSYT SSEEDLEKLF SAYGPLSELH YPIDSLTKKP KGFAFVTFMF
460 470 480 490 500
PEHAVKAYAE VDGQVFQGRM LHVLPSTIKK EASQEANAPG SSYKKKKEAM
510 520 530 540 550
DKANSSSSHN WNTLFMGPNA VADAIAQKYN ATKSQVFDHE TRGSVAVRVA
560 570 580 590 600
LGETQLVQEV RSFLIDNGVC LDSFSQAAAE RSKTVILAKN LPAGTLAAEI
610 620 630 640 650
QETFSRFGSL GRVLLPEGGI TAIVEFLEPL EARKAFRHLA YSKFHHVPLY
660 670 680 690 700
LEWAPIGVFG AAPQKKDSQH EQPAEKAEVE QETVLDPEGE KASVEGAEAS
710 720 730 740 750
TGKMEEEEEE EEEEEEESIP GCTLFIKNLN FSTTEETLKG VFSKVGAIKS
760 770 780 790 800
CTISKKKNKA GVLLSMGFGF VEYKKPEQAQ KALKQLQGHT VDGHKLEVRI
810 820 830 840 850
SERATKPALT STRKKQVPKK QTTSKILVRN IPFQANQREI RELFSTFGEL
860 870 880 890 900
KTVRLPKKMT GTGAHRGFGF VDFITKQDAK KAFNALCHST HLYGRRLVLE
910 920 930 940 950
WADSEVTVQT LRRKTARHFQ EPPKKKRSAV LDGILEQLED EDNSDGEQAL

QL
Length:952
Mass (Da):106,083
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i91C45ADB66F8CDB2
GO
Isoform 2 (identifier: Q8R3C6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     485-521: EANAPGSSYKKKKEAMDKANSSSSHNWNTLFMGPNAV → APAALSPPQQDCWPVDRAGDSTSSSGPLPCPCDAARF
     522-952: Missing.

Show »
Length:521
Mass (Da):57,940
Checksum:i83C0C09AD3AB0BB2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0J9YUT8A0A0J9YUT8_MOUSE
Probable RNA-binding protein 19
Rbm19
870Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_015005485 – 521EANAP…GPNAV → APAALSPPQQDCWPVDRAGD STSSSGPLPCPCDAARF in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_015006522 – 952Missing in isoform 2. 1 PublicationAdd BLAST431

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BC025619 mRNA Translation: AAH25619.1
BC034010 mRNA Translation: AAH34010.1
AK004657 mRNA Translation: BAB23448.1
AK053511 mRNA Translation: BAC35411.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS19616.1 [Q8R3C6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_083038.1, NM_028762.1 [Q8R3C6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594 [Q8R3C6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
74111

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:74111

UCSC genome browser

More...
UCSCi
uc008zha.1, mouse [Q8R3C6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC025619 mRNA Translation: AAH25619.1
BC034010 mRNA Translation: AAH34010.1
AK004657 mRNA Translation: BAB23448.1
AK053511 mRNA Translation: BAC35411.1
CCDSiCCDS19616.1 [Q8R3C6-1]
RefSeqiNP_083038.1, NM_028762.1 [Q8R3C6-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WHWNMR-A399-484[»]
1WHXNMR-A581-678[»]
2CPFNMR-A724-808[»]
2CPHNMR-A816-909[»]
SMRiQ8R3C6
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi216500, 3 interactors
IntActiQ8R3C6, 1 interactor
MINTiQ8R3C6
STRINGi10090.ENSMUSP00000031590

PTM databases

iPTMnetiQ8R3C6
PhosphoSitePlusiQ8R3C6

Proteomic databases

EPDiQ8R3C6
PaxDbiQ8R3C6
PeptideAtlasiQ8R3C6
PRIDEiQ8R3C6
ProteomicsDBi255121 [Q8R3C6-1]
255122 [Q8R3C6-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31281, 51 antibodies

The DNASU plasmid repository

More...
DNASUi
74111

Genome annotation databases

EnsembliENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594 [Q8R3C6-1]
GeneIDi74111
KEGGimmu:74111
UCSCiuc008zha.1, mouse [Q8R3C6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9904
MGIiMGI:1921361, Rbm19

Phylogenomic databases

eggNOGiKOG0110, Eukaryota
GeneTreeiENSGT00840000129953
HOGENOMiCLU_008479_1_0_1
InParanoidiQ8R3C6
OrthoDBi1428854at2759
PhylomeDBiQ8R3C6
TreeFamiTF105725

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
74111, 19 hits in 53 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Rbm19, mouse
EvolutionaryTraceiQ8R3C6

Protein Ontology

More...
PROi
PR:Q8R3C6
RNActiQ8R3C6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000029594, Expressed in dorsal pancreas and 258 other tissues
GenevisibleiQ8R3C6, MM

Family and domain databases

CDDicd12564, RRM1_RBM19, 1 hit
cd12502, RRM2_RMB19, 1 hit
cd12567, RRM3_RBM19, 1 hit
cd12569, RRM4_RBM19, 1 hit
cd12318, RRM5_RBM19_like, 1 hit
cd12571, RRM6_RBM19, 1 hit
Gene3Di3.30.70.330, 6 hits
InterProiView protein in InterPro
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR034419, RBM19_RRM3
IPR034420, RBM19_RRM4
IPR034423, RBM19_RRM5
IPR034421, RBM19_RRM6
IPR034418, RMB19_RRM1
IPR034417, RMB19_RRM2
IPR000504, RRM_dom
IPR003954, RRM_dom_euk
PfamiView protein in Pfam
PF00076, RRM_1, 5 hits
SMARTiView protein in SMART
SM00360, RRM, 6 hits
SM00361, RRM_1, 2 hits
SUPFAMiSSF54928, SSF54928, 5 hits
PROSITEiView protein in PROSITE
PS50102, RRM, 6 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBM19_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8R3C6
Secondary accession number(s): Q8BHR0, Q9CW63
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: June 1, 2002
Last modified: June 2, 2021
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again