Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable RNA-binding protein 19

Gene

Rbm19

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in embryo pre-implantation development.1 Publication

GO - Molecular functioni

  • RNA binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable RNA-binding protein 19
Alternative name(s):
RNA-binding motif protein 19
Gene namesi
Name:Rbm19
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1921361 Rbm19

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

Pathology & Biotechi

Disruption phenotypei

Arrests embryonic development prior to implantation. Embryos at 3.5 dpc lack the mature, tripartite nucleoli, but instead, contain spheres resembling nucleolar precursor body (NPB), indicating arrest of nucleologenesis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000817821 – 952Probable RNA-binding protein 19Add BLAST952

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei177PhosphoserineBy similarity1
Modified residuei179PhosphoserineBy similarity1
Modified residuei183PhosphoserineBy similarity1
Cross-linki479Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei693PhosphoserineCombined sources1
Modified residuei928PhosphoserineBy similarity1
Modified residuei944PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8R3C6
PaxDbiQ8R3C6
PeptideAtlasiQ8R3C6
PRIDEiQ8R3C6

PTM databases

iPTMnetiQ8R3C6
PhosphoSitePlusiQ8R3C6

Expressioni

Tissue specificityi

Expressed in the crypts of Lieberkuhn of the intestine (at protein level).1 Publication

Developmental stagei

Expressed during early development. Expressed in the epithelium of the embryonic gut tube (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000029594 Expressed in 230 organ(s), highest expression level in dorsal pancreas
CleanExiMM_RBM19
ExpressionAtlasiQ8R3C6 baseline and differential
GenevisibleiQ8R3C6 MM

Interactioni

Protein-protein interaction databases

BioGridi216500, 3 interactors
IntActiQ8R3C6, 1 interactor
MINTiQ8R3C6
STRINGi10090.ENSMUSP00000031590

Structurei

Secondary structure

1952
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8R3C6
SMRiQ8R3C6
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8R3C6

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 79RRM 1PROSITE-ProRule annotationAdd BLAST78
Domaini293 – 368RRM 2PROSITE-ProRule annotationAdd BLAST76
Domaini400 – 478RRM 3PROSITE-ProRule annotationAdd BLAST79
Domaini584 – 656RRM 4PROSITE-ProRule annotationAdd BLAST73
Domaini722 – 803RRM 5PROSITE-ProRule annotationAdd BLAST82
Domaini824 – 904RRM 6PROSITE-ProRule annotationAdd BLAST81

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi182 – 250Asp/Glu-richAdd BLAST69
Compositional biasi389 – 394Poly-Glu6
Compositional biasi671 – 717Glu-richAdd BLAST47

Sequence similaritiesi

Belongs to the RRM MRD1 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0110 Eukaryota
ENOG410XQZ5 LUCA
GeneTreeiENSGT00840000129953
HOGENOMiHOG000211156
HOVERGENiHBG055637
InParanoidiQ8R3C6
KOiK14787
OrthoDBiEOG091G02IZ
PhylomeDBiQ8R3C6
TreeFamiTF105725

Family and domain databases

CDDicd12564 RRM1_RBM19, 1 hit
cd12502 RRM2_RMB19, 1 hit
cd12567 RRM3_RBM19, 1 hit
cd12569 RRM4_RBM19, 1 hit
cd12318 RRM5_RBM19_like, 1 hit
cd12571 RRM6_RBM19, 1 hit
Gene3Di3.30.70.330, 6 hits
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR034419 RBM19_RRM3
IPR034420 RBM19_RRM4
IPR034423 RBM19_RRM5
IPR034421 RBM19_RRM6
IPR034418 RMB19_RRM1
IPR034417 RMB19_RRM2
IPR000504 RRM_dom
IPR003954 RRM_dom_euk
PfamiView protein in Pfam
PF00076 RRM_1, 5 hits
SMARTiView protein in SMART
SM00360 RRM, 6 hits
SM00361 RRM_1, 2 hits
SUPFAMiSSF54928 SSF54928, 5 hits
PROSITEiView protein in PROSITE
PS50102 RRM, 6 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8R3C6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRLIVKNLP NGMKEERFRQ LFAAFGTLTD CSLKFTKDGK FRKFGFIGFK
60 70 80 90 100
SEEEAQAALN HFHRSFIDTT RITVEFCKSF GDPSKPRAWS KHAQKSSQPK
110 120 130 140 150
QPSQDSVPSD TKKDKKKKGP SDLEKLKEDA KFQEFLSIHQ KRTQVATWAN
160 170 180 190 200
DALEAKLPKA KTKASSDYLN FDSDSNSDSG QESEEEPARE DPEEEQGLQP
210 220 230 240 250
KAAVQKELSD MDYLKSKMVR AEVSSEDEDE EDSEDEAVNC EEGSEEEEEE
260 270 280 290 300
GSPASPAKQG GVSRGAVPGV LRPQEAAGKV EKPVSQKEPT TPYTVKLRGA
310 320 330 340 350
PFNVTEKNVI EFLAPLKPVA IRIVRNAHGN KTGYVFVDLS SEEEVKKALK
360 370 380 390 400
CNRDYMGGRY IEVFREKQAP TARGPPKSTT PWQGRTLGEN EEEEDLADSG
410 420 430 440 450
RLFVRNLSYT SSEEDLEKLF SAYGPLSELH YPIDSLTKKP KGFAFVTFMF
460 470 480 490 500
PEHAVKAYAE VDGQVFQGRM LHVLPSTIKK EASQEANAPG SSYKKKKEAM
510 520 530 540 550
DKANSSSSHN WNTLFMGPNA VADAIAQKYN ATKSQVFDHE TRGSVAVRVA
560 570 580 590 600
LGETQLVQEV RSFLIDNGVC LDSFSQAAAE RSKTVILAKN LPAGTLAAEI
610 620 630 640 650
QETFSRFGSL GRVLLPEGGI TAIVEFLEPL EARKAFRHLA YSKFHHVPLY
660 670 680 690 700
LEWAPIGVFG AAPQKKDSQH EQPAEKAEVE QETVLDPEGE KASVEGAEAS
710 720 730 740 750
TGKMEEEEEE EEEEEEESIP GCTLFIKNLN FSTTEETLKG VFSKVGAIKS
760 770 780 790 800
CTISKKKNKA GVLLSMGFGF VEYKKPEQAQ KALKQLQGHT VDGHKLEVRI
810 820 830 840 850
SERATKPALT STRKKQVPKK QTTSKILVRN IPFQANQREI RELFSTFGEL
860 870 880 890 900
KTVRLPKKMT GTGAHRGFGF VDFITKQDAK KAFNALCHST HLYGRRLVLE
910 920 930 940 950
WADSEVTVQT LRRKTARHFQ EPPKKKRSAV LDGILEQLED EDNSDGEQAL

QL
Length:952
Mass (Da):106,083
Last modified:June 1, 2002 - v1
Checksum:i91C45ADB66F8CDB2
GO
Isoform 2 (identifier: Q8R3C6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     485-521: EANAPGSSYKKKKEAMDKANSSSSHNWNTLFMGPNAV → APAALSPPQQDCWPVDRAGDSTSSSGPLPCPCDAARF
     522-952: Missing.

Show »
Length:521
Mass (Da):57,940
Checksum:i83C0C09AD3AB0BB2
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0J9YUT8A0A0J9YUT8_MOUSE
Probable RNA-binding protein 19
Rbm19
870Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015005485 – 521EANAP…GPNAV → APAALSPPQQDCWPVDRAGD STSSSGPLPCPCDAARF in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_015006522 – 952Missing in isoform 2. 1 PublicationAdd BLAST431

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC025619 mRNA Translation: AAH25619.1
BC034010 mRNA Translation: AAH34010.1
AK004657 mRNA Translation: BAB23448.1
AK053511 mRNA Translation: BAC35411.1
CCDSiCCDS19616.1 [Q8R3C6-1]
RefSeqiNP_083038.1, NM_028762.1 [Q8R3C6-1]
UniGeneiMm.41022

Genome annotation databases

EnsembliENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594 [Q8R3C6-1]
GeneIDi74111
KEGGimmu:74111
UCSCiuc008zha.1 mouse [Q8R3C6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC025619 mRNA Translation: AAH25619.1
BC034010 mRNA Translation: AAH34010.1
AK004657 mRNA Translation: BAB23448.1
AK053511 mRNA Translation: BAC35411.1
CCDSiCCDS19616.1 [Q8R3C6-1]
RefSeqiNP_083038.1, NM_028762.1 [Q8R3C6-1]
UniGeneiMm.41022

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WHWNMR-A399-484[»]
1WHXNMR-A581-678[»]
2CPFNMR-A724-808[»]
2CPHNMR-A816-909[»]
ProteinModelPortaliQ8R3C6
SMRiQ8R3C6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi216500, 3 interactors
IntActiQ8R3C6, 1 interactor
MINTiQ8R3C6
STRINGi10090.ENSMUSP00000031590

PTM databases

iPTMnetiQ8R3C6
PhosphoSitePlusiQ8R3C6

Proteomic databases

EPDiQ8R3C6
PaxDbiQ8R3C6
PeptideAtlasiQ8R3C6
PRIDEiQ8R3C6

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594 [Q8R3C6-1]
GeneIDi74111
KEGGimmu:74111
UCSCiuc008zha.1 mouse [Q8R3C6-1]

Organism-specific databases

CTDi9904
MGIiMGI:1921361 Rbm19

Phylogenomic databases

eggNOGiKOG0110 Eukaryota
ENOG410XQZ5 LUCA
GeneTreeiENSGT00840000129953
HOGENOMiHOG000211156
HOVERGENiHBG055637
InParanoidiQ8R3C6
KOiK14787
OrthoDBiEOG091G02IZ
PhylomeDBiQ8R3C6
TreeFamiTF105725

Miscellaneous databases

EvolutionaryTraceiQ8R3C6
PROiPR:Q8R3C6
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029594 Expressed in 230 organ(s), highest expression level in dorsal pancreas
CleanExiMM_RBM19
ExpressionAtlasiQ8R3C6 baseline and differential
GenevisibleiQ8R3C6 MM

Family and domain databases

CDDicd12564 RRM1_RBM19, 1 hit
cd12502 RRM2_RMB19, 1 hit
cd12567 RRM3_RBM19, 1 hit
cd12569 RRM4_RBM19, 1 hit
cd12318 RRM5_RBM19_like, 1 hit
cd12571 RRM6_RBM19, 1 hit
Gene3Di3.30.70.330, 6 hits
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR034419 RBM19_RRM3
IPR034420 RBM19_RRM4
IPR034423 RBM19_RRM5
IPR034421 RBM19_RRM6
IPR034418 RMB19_RRM1
IPR034417 RMB19_RRM2
IPR000504 RRM_dom
IPR003954 RRM_dom_euk
PfamiView protein in Pfam
PF00076 RRM_1, 5 hits
SMARTiView protein in SMART
SM00360 RRM, 6 hits
SM00361 RRM_1, 2 hits
SUPFAMiSSF54928 SSF54928, 5 hits
PROSITEiView protein in PROSITE
PS50102 RRM, 6 hits
ProtoNetiSearch...

Entry informationi

Entry nameiRBM19_MOUSE
AccessioniPrimary (citable) accession number: Q8R3C6
Secondary accession number(s): Q8BHR0, Q9CW63
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: June 1, 2002
Last modified: November 7, 2018
This is version 137 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again