Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nucleoporin p58/p45

Gene

Nup58

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the nuclear pore complex, a complex required for the trafficking across the nuclear membrane.By similarity

Miscellaneous

In rat, the p62 complex contains two different isoforms of NUP58. Isoform p45 has however not been isolated in mouse so far.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiR-MMU-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-MMU-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-MMU-191859 snRNP Assembly
R-MMU-3108214 SUMOylation of DNA damage response and repair proteins
R-MMU-3232142 SUMOylation of ubiquitinylation proteins
R-MMU-3301854 Nuclear Pore Complex (NPC) Disassembly
R-MMU-3371453 Regulation of HSF1-mediated heat shock response
R-MMU-4085377 SUMOylation of SUMOylation proteins
R-MMU-4551638 SUMOylation of chromatin organization proteins
R-MMU-4570464 SUMOylation of RNA binding proteins
R-MMU-4615885 SUMOylation of DNA replication proteins
R-MMU-5578749 Transcriptional regulation by small RNAs

Names & Taxonomyi

Protein namesi
Recommended name:
Nucleoporin p58/p45Curated
Alternative name(s):
58 kDa nucleoporinBy similarity
Nucleoporin-like protein 1
Gene namesi
Name:Nup58By similarity
Synonyms:Nupl1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1919094 Nupl1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane, Nuclear pore complex, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002048931 – 587Nucleoporin p58/p45Add BLAST587

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei319PhosphothreonineBy similarity1

Post-translational modificationi

O-glycosylated.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ8R332
PRIDEiQ8R332

PTM databases

iPTMnetiQ8R332
PhosphoSitePlusiQ8R332

Expressioni

Gene expression databases

BgeeiENSMUSG00000063895 Expressed in 266 organ(s), highest expression level in humerus cartilage element
CleanExiMM_NUPL1
GenevisibleiQ8R332 MM

Interactioni

Subunit structurei

Component of the p62 complex, a complex at least composed of NUP62, NUP54, and NUP58. Interacts with NUTF2. Interacts with SRP1-alpha and Importin p97 proteins when they are together, but not with SRP1-alpha protein alone (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Mapk1P630853EBI-646962,EBI-397697

Protein-protein interaction databases

IntActiQ8R332, 3 interactors
MINTiQ8R332
STRINGi10090.ENSMUSP00000038716

Structurei

3D structure databases

ProteinModelPortaliQ8R332
SMRiQ8R332
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati7 – 812
Repeati30 – 3122
Repeati44 – 4532
Repeati63 – 6442
Repeati68 – 6952
Repeati476 – 47762
Repeati480 – 48172
Repeati501 – 50282
Repeati507 – 50892
Repeati517 – 518102
Repeati519 – 520112
Repeati533 – 534122
Repeati556 – 557132
Repeati566 – 567142

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni7 – 56714 X 2 AA repeats of F-GAdd BLAST561

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili244 – 264Sequence analysisAdd BLAST21
Coiled coili302 – 369Sequence analysisAdd BLAST68

Domaini

Contains FG repeats.

Sequence similaritiesi

Belongs to the NUP58 family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IIR3 Eukaryota
ENOG410ZJAM LUCA
GeneTreeiENSGT00730000111111
HOGENOMiHOG000273874
HOVERGENiHBG052703
InParanoidiQ8R332
KOiK14307
OMAiFFPSQSS
OrthoDBiEOG091G0KUR
PhylomeDBiQ8R332
TreeFamiTF106502

Family and domain databases

InterProiView protein in InterPro
IPR024882 Nucleoporin_p58/p45
PANTHERiPTHR13437 PTHR13437, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8R332-1) [UniParc]FASTAAdd to basket
Also known as: p58

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGFSFGSG TLGSTTVAPG GTGAGSGFSF GTVASSTPSV GLNFGSLGSS
60 70 80 90 100
VTPASTSASA GGFGTGLFGS KPATGFTLGG TSAGTAATTS ASTTGFSLGF
110 120 130 140 150
SKPAASATPF ALPVTSTSAS GLTLSSALTS TPAASTGFTL NNLGATPATT
160 170 180 190 200
TTASTGLSLG GALAGLGGSL FQSGNTATSG LGQNALSLSL GTTAPTSAAS
210 220 230 240 250
NEGLGGIDFS TSSDKKSDKT GTRPEDSKAL KDENLPPVIC QDVENLQKFV
260 270 280 290 300
KEQKQVQEEI SRMSSKAMLK VQEDIKALKQ LLSLAASGLQ RNTLNIDKLK
310 320 330 340 350
LETAQELKNA EIALRTQKTP PGLQHENTAP ADYFRILVQQ FEVQLQQYRQ
360 370 380 390 400
QIEELENHLA TQASNSHITP QDLSMAMQKI YQTFVALAAQ LQSIHENVKV
410 420 430 440 450
LKEQYLGYRK MFLGDAVDVF EARRTEAKKW QNAPRVTTGP TPFSTMPNAA
460 470 480 490 500
AVAMAATLTQ QQQPATGPQP SLGVSFGTPF GSGIGTGLQS SGLGSSNLGG
510 520 530 540 550
FGTSSGFGCG TTGASTFGFG TTDKPSGSLS AGFGSSSTSG FNFSNPGITA
560 570 580
SAGLTFGVSN PASAGFGTGG QLLQLKRPPA GNKRGKR
Length:587
Mass (Da):59,445
Last modified:June 1, 2002 - v1
Checksum:i697E22078331BF0A
GO
Isoform 2 (identifier: Q8R332-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     533-587: FGSSSTSGFN...PPAGNKRGKR → QKSHVLTGFRKPSVMETNELGRKIQF

Note: No experimental confirmation available.
Show »
Length:558
Mass (Da):57,020
Checksum:i8FCD7AFB782EC2C9
GO
Isoform 3 (identifier: Q8R332-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     533-587: FGSSSTSGFNFSNPGITASAGLTFGVSNPASAGFGTGGQLLQLKRPPAGNKRGKR → LCASA

Note: No experimental confirmation available.
Show »
Length:537
Mass (Da):54,452
Checksum:iE09C0B801C2B37BB
GO
Isoform 4 (identifier: Q8R332-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     533-587: Missing.

Note: No experimental confirmation available.
Show »
Length:532
Mass (Da):54,006
Checksum:i2B37BBEB0F3C160C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti55S → Y in BAC26564 (PubMed:16141072).Curated1
Sequence conflicti78L → V in BAC26564 (PubMed:16141072).Curated1
Sequence conflicti117T → A in BAC39663 (PubMed:16141072).Curated1
Sequence conflicti143L → F in BAC37200 (PubMed:16141072).Curated1
Sequence conflicti513G → E in BAC26564 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_008573533 – 587FGSSS…KRGKR → QKSHVLTGFRKPSVMETNEL GRKIQF in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_008574533 – 587FGSSS…KRGKR → LCASA in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_008575533 – 587Missing in isoform 4. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029688 mRNA Translation: BAC26564.1
AK078279 mRNA Translation: BAC37200.1
AK086412 mRNA Translation: BAC39663.1
AK146477 mRNA Translation: BAE27201.1
BC026743 mRNA Translation: AAH26743.1
CCDSiCCDS27175.1 [Q8R332-1]
RefSeqiNP_733479.1, NM_170591.1 [Q8R332-1]
UniGeneiMm.258051

Genome annotation databases

EnsembliENSMUST00000041905; ENSMUSP00000038716; ENSMUSG00000114797 [Q8R332-1]
ENSMUST00000225111; ENSMUSP00000153625; ENSMUSG00000114797 [Q8R332-3]
ENSMUST00000225311; ENSMUSP00000153117; ENSMUSG00000114797 [Q8R332-2]
ENSMUST00000225805; ENSMUSP00000153642; ENSMUSG00000063895 [Q8R332-4]
GeneIDi71844
KEGGimmu:71844
UCSCiuc007uex.1 mouse [Q8R332-2]
uc007uey.1 mouse [Q8R332-3]
uc007uez.1 mouse [Q8R332-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029688 mRNA Translation: BAC26564.1
AK078279 mRNA Translation: BAC37200.1
AK086412 mRNA Translation: BAC39663.1
AK146477 mRNA Translation: BAE27201.1
BC026743 mRNA Translation: AAH26743.1
CCDSiCCDS27175.1 [Q8R332-1]
RefSeqiNP_733479.1, NM_170591.1 [Q8R332-1]
UniGeneiMm.258051

3D structure databases

ProteinModelPortaliQ8R332
SMRiQ8R332
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8R332, 3 interactors
MINTiQ8R332
STRINGi10090.ENSMUSP00000038716

PTM databases

iPTMnetiQ8R332
PhosphoSitePlusiQ8R332

Proteomic databases

PaxDbiQ8R332
PRIDEiQ8R332

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000041905; ENSMUSP00000038716; ENSMUSG00000114797 [Q8R332-1]
ENSMUST00000225111; ENSMUSP00000153625; ENSMUSG00000114797 [Q8R332-3]
ENSMUST00000225311; ENSMUSP00000153117; ENSMUSG00000114797 [Q8R332-2]
ENSMUST00000225805; ENSMUSP00000153642; ENSMUSG00000063895 [Q8R332-4]
GeneIDi71844
KEGGimmu:71844
UCSCiuc007uex.1 mouse [Q8R332-2]
uc007uey.1 mouse [Q8R332-3]
uc007uez.1 mouse [Q8R332-1]

Organism-specific databases

CTDi71844
MGIiMGI:1919094 Nupl1

Phylogenomic databases

eggNOGiENOG410IIR3 Eukaryota
ENOG410ZJAM LUCA
GeneTreeiENSGT00730000111111
HOGENOMiHOG000273874
HOVERGENiHBG052703
InParanoidiQ8R332
KOiK14307
OMAiFFPSQSS
OrthoDBiEOG091G0KUR
PhylomeDBiQ8R332
TreeFamiTF106502

Enzyme and pathway databases

ReactomeiR-MMU-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-MMU-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-MMU-191859 snRNP Assembly
R-MMU-3108214 SUMOylation of DNA damage response and repair proteins
R-MMU-3232142 SUMOylation of ubiquitinylation proteins
R-MMU-3301854 Nuclear Pore Complex (NPC) Disassembly
R-MMU-3371453 Regulation of HSF1-mediated heat shock response
R-MMU-4085377 SUMOylation of SUMOylation proteins
R-MMU-4551638 SUMOylation of chromatin organization proteins
R-MMU-4570464 SUMOylation of RNA binding proteins
R-MMU-4615885 SUMOylation of DNA replication proteins
R-MMU-5578749 Transcriptional regulation by small RNAs

Miscellaneous databases

PROiPR:Q8R332
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000063895 Expressed in 266 organ(s), highest expression level in humerus cartilage element
CleanExiMM_NUPL1
GenevisibleiQ8R332 MM

Family and domain databases

InterProiView protein in InterPro
IPR024882 Nucleoporin_p58/p45
PANTHERiPTHR13437 PTHR13437, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNUP58_MOUSE
AccessioniPrimary (citable) accession number: Q8R332
Secondary accession number(s): Q3UJF4
, Q8BUA7, Q8BVG7, Q8C0W3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: June 1, 2002
Last modified: November 7, 2018
This is version 136 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again