Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (02 Jun 2021)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Nucleoporin p58/p45

Gene

Nup58

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the nuclear pore complex, a complex required for the trafficking across the nuclear membrane.

By similarity

Miscellaneous

In rat, the p62 complex contains two different isoforms of NUP58. Isoform p45 has however not been isolated in mouse so far.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-159227, Transport of the SLBP independent Mature mRNA
R-MMU-159230, Transport of the SLBP Dependant Mature mRNA
R-MMU-159231, Transport of Mature mRNA Derived from an Intronless Transcript
R-MMU-159236, Transport of Mature mRNA derived from an Intron-Containing Transcript
R-MMU-170822, Regulation of Glucokinase by Glucokinase Regulatory Protein
R-MMU-191859, snRNP Assembly
R-MMU-3108214, SUMOylation of DNA damage response and repair proteins
R-MMU-3232142, SUMOylation of ubiquitinylation proteins
R-MMU-3301854, Nuclear Pore Complex (NPC) Disassembly
R-MMU-3371453, Regulation of HSF1-mediated heat shock response
R-MMU-4085377, SUMOylation of SUMOylation proteins
R-MMU-4551638, SUMOylation of chromatin organization proteins
R-MMU-4570464, SUMOylation of RNA binding proteins
R-MMU-4615885, SUMOylation of DNA replication proteins
R-MMU-5578749, Transcriptional regulation by small RNAs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nucleoporin p58/p45Curated
Alternative name(s):
58 kDa nucleoporinBy similarity
Nucleoporin-like protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nup58By similarity
Synonyms:Nupl1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1919094, Nupl1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Membrane, Nuclear pore complex, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002048931 – 587Nucleoporin p58/p45Add BLAST587

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei319PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8R332

PRoteomics IDEntifications database

More...
PRIDEi
Q8R332

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
294251 [Q8R332-1]
294252 [Q8R332-2]
294253 [Q8R332-3]
294254 [Q8R332-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8R332

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8R332

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000063895, Expressed in humerus cartilage element and 289 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8R332, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the p62 complex, a complex at least composed of NUP62, NUP54, and NUP58.

Interacts with NUTF2.

Interacts with SRP1-alpha and Importin p97 proteins when they are together, but not with SRP1-alpha protein alone (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
214973, 1 interactor

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-4474, Nuclear pore complex

Protein interaction database and analysis system

More...
IntActi
Q8R332, 3 interactors

Molecular INTeraction database

More...
MINTi
Q8R332

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000038716

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8R332, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8R332

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati7 – 812
Repeati30 – 3122
Repeati44 – 4532
Repeati63 – 6442
Repeati68 – 6952
Repeati476 – 47762
Repeati480 – 48172
Repeati501 – 50282
Repeati507 – 50892
Repeati517 – 518102
Repeati519 – 520112
Repeati533 – 534122
Repeati556 – 557132
Repeati566 – 567142

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni7 – 56714 X 2 AA repeats of F-GAdd BLAST561
Regioni196 – 236DisorderedSequence analysisAdd BLAST41
Regioni565 – 587DisorderedSequence analysisAdd BLAST23

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili244 – 264Sequence analysisAdd BLAST21
Coiled coili302 – 369Sequence analysisAdd BLAST68

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi196 – 211Polar residuesSequence analysisAdd BLAST16
Compositional biasi212 – 232Basic and acidic residuesSequence analysisAdd BLAST21

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains FG repeats. FG repeats are interaction sites for karyopherins (importins, exportins) and form probably an affinity gradient, guiding the transport proteins unidirectionally with their cargo through the NPC. FG repeat regions are highly flexible and lack ordered secondary structure. The overall conservation of FG repeats regarding exact sequence, spacing, and repeat unit length is limited.Curated

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NUP58 family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRD8, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000111111

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_034851_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8R332

Identification of Orthologs from Complete Genome Data

More...
OMAi
YTQLRKW

Database of Orthologous Groups

More...
OrthoDBi
885529at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8R332

TreeFam database of animal gene trees

More...
TreeFami
TF106502

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024882, Nucleoporin_p58/p45

The PANTHER Classification System

More...
PANTHERi
PTHR13437, PTHR13437, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8R332-1) [UniParc]FASTAAdd to basket
Also known as: p58

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGFSFGSG TLGSTTVAPG GTGAGSGFSF GTVASSTPSV GLNFGSLGSS
60 70 80 90 100
VTPASTSASA GGFGTGLFGS KPATGFTLGG TSAGTAATTS ASTTGFSLGF
110 120 130 140 150
SKPAASATPF ALPVTSTSAS GLTLSSALTS TPAASTGFTL NNLGATPATT
160 170 180 190 200
TTASTGLSLG GALAGLGGSL FQSGNTATSG LGQNALSLSL GTTAPTSAAS
210 220 230 240 250
NEGLGGIDFS TSSDKKSDKT GTRPEDSKAL KDENLPPVIC QDVENLQKFV
260 270 280 290 300
KEQKQVQEEI SRMSSKAMLK VQEDIKALKQ LLSLAASGLQ RNTLNIDKLK
310 320 330 340 350
LETAQELKNA EIALRTQKTP PGLQHENTAP ADYFRILVQQ FEVQLQQYRQ
360 370 380 390 400
QIEELENHLA TQASNSHITP QDLSMAMQKI YQTFVALAAQ LQSIHENVKV
410 420 430 440 450
LKEQYLGYRK MFLGDAVDVF EARRTEAKKW QNAPRVTTGP TPFSTMPNAA
460 470 480 490 500
AVAMAATLTQ QQQPATGPQP SLGVSFGTPF GSGIGTGLQS SGLGSSNLGG
510 520 530 540 550
FGTSSGFGCG TTGASTFGFG TTDKPSGSLS AGFGSSSTSG FNFSNPGITA
560 570 580
SAGLTFGVSN PASAGFGTGG QLLQLKRPPA GNKRGKR
Length:587
Mass (Da):59,445
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i697E22078331BF0A
GO
Isoform 2 (identifier: Q8R332-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     533-587: FGSSSTSGFN...PPAGNKRGKR → QKSHVLTGFRKPSVMETNELGRKIQF

Show »
Length:558
Mass (Da):57,020
Checksum:i8FCD7AFB782EC2C9
GO
Isoform 3 (identifier: Q8R332-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     533-587: FGSSSTSGFNFSNPGITASAGLTFGVSNPASAGFGTGGQLLQLKRPPAGNKRGKR → LCASA

Show »
Length:537
Mass (Da):54,452
Checksum:iE09C0B801C2B37BB
GO
Isoform 4 (identifier: Q8R332-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     533-587: Missing.

Show »
Length:532
Mass (Da):54,006
Checksum:i2B37BBEB0F3C160C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti55S → Y in BAC26564 (PubMed:16141072).Curated1
Sequence conflicti78L → V in BAC26564 (PubMed:16141072).Curated1
Sequence conflicti117T → A in BAC39663 (PubMed:16141072).Curated1
Sequence conflicti143L → F in BAC37200 (PubMed:16141072).Curated1
Sequence conflicti513G → E in BAC26564 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_008573533 – 587FGSSS…KRGKR → QKSHVLTGFRKPSVMETNEL GRKIQF in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_008574533 – 587FGSSS…KRGKR → LCASA in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_008575533 – 587Missing in isoform 4. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK029688 mRNA Translation: BAC26564.1
AK078279 mRNA Translation: BAC37200.1
AK086412 mRNA Translation: BAC39663.1
AK146477 mRNA Translation: BAE27201.1
BC026743 mRNA Translation: AAH26743.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS27175.1 [Q8R332-1]
CCDS88679.1 [Q8R332-3]
CCDS88680.1 [Q8R332-2]

NCBI Reference Sequences

More...
RefSeqi
NP_733479.1, NM_170591.1 [Q8R332-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000041905; ENSMUSP00000038716; ENSMUSG00000114797 [Q8R332-1]
ENSMUST00000225111; ENSMUSP00000153625; ENSMUSG00000114797 [Q8R332-3]
ENSMUST00000225311; ENSMUSP00000153117; ENSMUSG00000114797 [Q8R332-2]
ENSMUST00000225805; ENSMUSP00000153642; ENSMUSG00000063895 [Q8R332-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
71844

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:71844

UCSC genome browser

More...
UCSCi
uc007uex.1, mouse [Q8R332-2]
uc007uey.1, mouse [Q8R332-3]
uc007uez.1, mouse [Q8R332-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029688 mRNA Translation: BAC26564.1
AK078279 mRNA Translation: BAC37200.1
AK086412 mRNA Translation: BAC39663.1
AK146477 mRNA Translation: BAE27201.1
BC026743 mRNA Translation: AAH26743.1
CCDSiCCDS27175.1 [Q8R332-1]
CCDS88679.1 [Q8R332-3]
CCDS88680.1 [Q8R332-2]
RefSeqiNP_733479.1, NM_170591.1 [Q8R332-1]

3D structure databases

SMRiQ8R332
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi214973, 1 interactor
ComplexPortaliCPX-4474, Nuclear pore complex
IntActiQ8R332, 3 interactors
MINTiQ8R332
STRINGi10090.ENSMUSP00000038716

PTM databases

iPTMnetiQ8R332
PhosphoSitePlusiQ8R332

Proteomic databases

PaxDbiQ8R332
PRIDEiQ8R332
ProteomicsDBi294251 [Q8R332-1]
294252 [Q8R332-2]
294253 [Q8R332-3]
294254 [Q8R332-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
71844

Genome annotation databases

EnsembliENSMUST00000041905; ENSMUSP00000038716; ENSMUSG00000114797 [Q8R332-1]
ENSMUST00000225111; ENSMUSP00000153625; ENSMUSG00000114797 [Q8R332-3]
ENSMUST00000225311; ENSMUSP00000153117; ENSMUSG00000114797 [Q8R332-2]
ENSMUST00000225805; ENSMUSP00000153642; ENSMUSG00000063895 [Q8R332-4]
GeneIDi71844
KEGGimmu:71844
UCSCiuc007uex.1, mouse [Q8R332-2]
uc007uey.1, mouse [Q8R332-3]
uc007uez.1, mouse [Q8R332-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
71844
MGIiMGI:1919094, Nupl1

Phylogenomic databases

eggNOGiENOG502QRD8, Eukaryota
GeneTreeiENSGT00730000111111
HOGENOMiCLU_034851_1_0_1
InParanoidiQ8R332
OMAiYTQLRKW
OrthoDBi885529at2759
PhylomeDBiQ8R332
TreeFamiTF106502

Enzyme and pathway databases

ReactomeiR-MMU-159227, Transport of the SLBP independent Mature mRNA
R-MMU-159230, Transport of the SLBP Dependant Mature mRNA
R-MMU-159231, Transport of Mature mRNA Derived from an Intronless Transcript
R-MMU-159236, Transport of Mature mRNA derived from an Intron-Containing Transcript
R-MMU-170822, Regulation of Glucokinase by Glucokinase Regulatory Protein
R-MMU-191859, snRNP Assembly
R-MMU-3108214, SUMOylation of DNA damage response and repair proteins
R-MMU-3232142, SUMOylation of ubiquitinylation proteins
R-MMU-3301854, Nuclear Pore Complex (NPC) Disassembly
R-MMU-3371453, Regulation of HSF1-mediated heat shock response
R-MMU-4085377, SUMOylation of SUMOylation proteins
R-MMU-4551638, SUMOylation of chromatin organization proteins
R-MMU-4570464, SUMOylation of RNA binding proteins
R-MMU-4615885, SUMOylation of DNA replication proteins
R-MMU-5578749, Transcriptional regulation by small RNAs

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
71844, 7 hits in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Nupl1, mouse

Protein Ontology

More...
PROi
PR:Q8R332
RNActiQ8R332, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000063895, Expressed in humerus cartilage element and 289 other tissues
GenevisibleiQ8R332, MM

Family and domain databases

InterProiView protein in InterPro
IPR024882, Nucleoporin_p58/p45
PANTHERiPTHR13437, PTHR13437, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNUP58_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8R332
Secondary accession number(s): Q3UJF4
, Q8BUA7, Q8BVG7, Q8C0W3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: June 1, 2002
Last modified: June 2, 2021
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again