Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell surface glycoprotein MUC18

Gene

Mcam

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration (By similarity).By similarity

GO - Biological processi

Keywordsi

Biological processCell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Cell surface glycoprotein MUC18
Alternative name(s):
Gicerin
Melanoma cell adhesion molecule
Melanoma-associated antigen MUC18
CD_antigen: CD146
Gene namesi
Name:Mcam
Synonyms:Muc18
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1933966 Mcam

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 563ExtracellularSequence analysisAdd BLAST540
Transmembranei564 – 584HelicalSequence analysisAdd BLAST21
Topological domaini585 – 648CytoplasmicSequence analysisAdd BLAST64

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23By similarityAdd BLAST23
ChainiPRO_000004546024 – 648Cell surface glycoprotein MUC18Add BLAST625

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi50 ↔ 118PROSITE-ProRule annotation
Glycosylationi58N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi163 ↔ 225PROSITE-ProRule annotation
Disulfide bondi274 ↔ 322PROSITE-ProRule annotation
Disulfide bondi367 ↔ 409PROSITE-ProRule annotation
Disulfide bondi454 ↔ 501PROSITE-ProRule annotation
Glycosylationi510N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei608PhosphoserineCombined sources1
Modified residuei616PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ8R2Y2
PeptideAtlasiQ8R2Y2
PRIDEiQ8R2Y2

PTM databases

iPTMnetiQ8R2Y2
PhosphoSitePlusiQ8R2Y2
SwissPalmiQ8R2Y2

Expressioni

Tissue specificityi

Detected in melanoma cell lines.1 Publication

Gene expression databases

BgeeiENSMUSG00000032135 Expressed in 203 organ(s), highest expression level in aorta
CleanExiMM_MCAM
ExpressionAtlasiQ8R2Y2 baseline and differential
GenevisibleiQ8R2Y2 MM

Interactioni

Protein-protein interaction databases

IntActiQ8R2Y2, 1 interactor
MINTiQ8R2Y2
STRINGi10090.ENSMUSP00000034650

Structurei

3D structure databases

ProteinModelPortaliQ8R2Y2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 131Ig-like V-type 1Add BLAST108
Domaini141 – 244Ig-like V-type 2Add BLAST104
Domaini246 – 332Ig-like C2-type 1Add BLAST87
Domaini337 – 426Ig-like C2-type 2Add BLAST90
Domaini432 – 512Ig-like C2-type 3Add BLAST81

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEC2 Eukaryota
ENOG4110RPG LUCA
GeneTreeiENSGT00530000063457
HOGENOMiHOG000015427
HOVERGENiHBG002808
InParanoidiQ8R2Y2
KOiK06534
OMAiGDQGEKY
OrthoDBiEOG091G072E
PhylomeDBiQ8R2Y2
TreeFamiTF330534

Family and domain databases

Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR013162 CD80_C2-set
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF08205 C2-set_2, 1 hit
PF07679 I-set, 1 hit
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 4 hits
SM00408 IGc2, 4 hits
SUPFAMiSSF48726 SSF48726, 5 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 4 hits

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q8R2Y2-1) [UniParc]FASTAAdd to basket
Also known as: L-gicerin

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLPKLVCVF LFAACCCCRR AAGVPGEEKQ PVPTPDLVEA EVGSTALLKC
60 70 80 90 100
GPSRASGNFS QVDWFLIHKE RQILIFRVHQ GKGQREPGEY EHRLSLQDSV
110 120 130 140 150
ATLALSHVTP HDERMFLCKS KRPRLQDHYV ELQVFKAPEE PTIQANVVGI
160 170 180 190 200
HVDRQELREV ATCVGRNGYP IPQVLWYKNS LPLQEEENRV HIQSSQIVES
210 220 230 240 250
SGLYTLKSVL SARLVKEDKD AQFYCELSYR LPSGNHMKES KEVTVPVFYP
260 270 280 290 300
AEKVWVEVEP VGLLKEGDHV TIRCLTDGNP QPHFTINKKD PSTGEMEEES
310 320 330 340 350
TDENGLLSLE PAEKHHSGLY QCQSLDLETT ITLSSDPLEL LVNYVSDVQV
360 370 380 390 400
NPTAPEVQEG ESLTLTCEAE SNQDLEFEWL RDKTGQLLGK GPVLQLNNVR
410 420 430 440 450
REAGGRYLCM ASVPRVPGLN RTQLVSVGIF GSPWMALKER KVWVQENAVL
460 470 480 490 500
NLSCEASGHP QPTISWNVNG SATEWNPDPQ TVVSTLNVLV TPELLETGAE
510 520 530 540 550
CTASNSLGSN TTTIVLKLVT LTTLIPDSSQ TTGLSTLTVS PHTRANSTST
560 570 580 590 600
EKKLPQPESK GVVIVAVIVC TLVLAVLGAA LYFFYKKGKL PCGRSGKQEI
610 620 630 640
TLPPTRKSEF VVEVKSDKLP EEMALLQGSN GDKRAPGDQG EKYIDLRH
Length:648
Mass (Da):71,545
Last modified:June 1, 2002 - v1
Checksum:iE468DABDB56C28FD
GO
Isoform 2 (identifier: Q8R2Y2-2) [UniParc]FASTAAdd to basket
Also known as: S-gicerin

The sequence of this isoform differs from the canonical sequence as follows:
     600-648: ITLPPTRKSEFVVEVKSDKLPEEMALLQGSNGDKRAPGDQGEKYIDLRH → MERNTSI

Show »
Length:606
Mass (Da):66,901
Checksum:iD53CBAC0A5F2967D
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1L1SQC5A0A1L1SQC5_MOUSE
Cell surface glycoprotein MUC18
Mcam
142Annotation score:
D6RFP0D6RFP0_MOUSE
Cell surface glycoprotein MUC18
Mcam
146Annotation score:
F7ATH5F7ATH5_MOUSE
Cell surface glycoprotein MUC18
Mcam
149Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti584F → L in BAB16050 (Ref. 1) Curated1
Sequence conflicti584F → L in BAB16051 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016940600 – 648ITLPP…IDLRH → MERNTSI in isoform 2. 2 PublicationsAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB035508 mRNA Translation: BAB16050.1
AB035509 mRNA Translation: BAB16051.1
BC026985 mRNA Translation: AAH26985.1
AJ297450 mRNA Translation: CAB97362.1
AJ297451 mRNA Translation: CAB97363.1
CCDSiCCDS23097.1 [Q8R2Y2-1]
RefSeqiNP_075548.2, NM_023061.2 [Q8R2Y2-1]
XP_006510779.1, XM_006510716.2
UniGeneiMm.275003

Genome annotation databases

EnsembliENSMUST00000034650; ENSMUSP00000034650; ENSMUSG00000032135 [Q8R2Y2-1]
ENSMUST00000098852; ENSMUSP00000096451; ENSMUSG00000032135 [Q8R2Y2-2]
GeneIDi84004
KEGGimmu:84004
UCSCiuc009pbw.2 mouse [Q8R2Y2-1]
uc009pbx.2 mouse [Q8R2Y2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMUC18_MOUSE
AccessioniPrimary (citable) accession number: Q8R2Y2
Secondary accession number(s): Q9EPF1
, Q9ESS7, Q9JHQ2, Q9JHQ3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: June 1, 2002
Last modified: September 12, 2018
This is version 134 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again