Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2

Gene

Degs2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Bifunctional enzyme which acts as both a sphingolipid delta4-desaturase and a sphingolipid C4-monooxygenase.3 Publications

Catalytic activityi

A dihydroceramide + 2 ferrocytochrome b5 + O2 + 2 H+ = a (4R)-4-hydroxysphinganine ceramide + 2 ferricytochrome b5 + H2O.2 Publications
A dihydroceramide + 2 ferrocytochrome b5 + O2 + 2 H+ = a (4E)-sphing-4-enine ceramide + 2 ferricytochrome b5 + 2 H2O.2 Publications

pH dependencei

Optimum pH is 7.0-8.0.1 Publication

Pathwayi: sphingolipid biosynthesis

This protein is involved in the pathway sphingolipid biosynthesis, which is part of Membrane lipid metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway sphingolipid biosynthesis and in Membrane lipid metabolism.

GO - Molecular functioni

  • sphingolipid delta-4 desaturase activity Source: MGI
  • sphingosine hydroxylase activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
Biological processLipid biosynthesis, Lipid metabolism

Enzyme and pathway databases

ReactomeiR-MMU-1660661 Sphingolipid de novo biosynthesis
UniPathwayi
UPA00786

Chemistry databases

SwissLipidsiSLP:000000168

Names & Taxonomyi

Protein namesi
Recommended name:
Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 (EC:1.14.18.52 Publications, EC:1.14.19.172 Publications)
Alternative name(s):
Degenerative spermatocyte homolog 2
Sphingolipid 4-desaturase
Sphingolipid C4-monooxygenase
Gene namesi
Name:Degs2Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:1917309 Degs2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei41 – 61HelicalSequence analysisAdd BLAST21
Transmembranei68 – 88HelicalSequence analysisAdd BLAST21
Transmembranei210 – 231HelicalSequence analysisAdd BLAST22

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00003128172 – 323Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2By similarityAdd BLAST322

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineBy similarity1

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

PaxDbiQ8R2F2
PRIDEiQ8R2F2

PTM databases

PhosphoSitePlusiQ8R2F2

Expressioni

Tissue specificityi

Highly expressed in intestinal crypt cells and adjacent epithelial cells (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000021263 Expressed in 95 organ(s), highest expression level in decidua
ExpressionAtlasiQ8R2F2 baseline and differential
GenevisibleiQ8R2F2 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000021691

Structurei

3D structure databases

ProteinModelPortaliQ8R2F2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni95 – 99Required for C4-hydroxylase activity1 Publication5

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi89 – 93Histidine box-1Curated5
Motifi128 – 132Histidine box-2Curated5
Motifi259 – 263Histidine box-3Curated5

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2987 Eukaryota
ENOG410XQVT LUCA
GeneTreeiENSGT00390000013448
HOGENOMiHOG000188299
HOVERGENiHBG052775
InParanoidiQ8R2F2
KOiK04712
OMAiPQHHSWV
OrthoDBiEOG091G09NW
PhylomeDBiQ8R2F2
TreeFamiTF313582

Family and domain databases

CDDicd03508 Delta4-sphingolipid-FADS-like, 1 hit
InterProiView protein in InterPro
IPR011388 DES1/DES2
IPR005804 FA_desaturase_dom
IPR013866 Sphingolipid_d4-desaturase_N
PfamiView protein in Pfam
PF00487 FA_desaturase, 1 hit
PF08557 Lipid_DES, 1 hit
PIRSFiPIRSF017228 Sphnglp_dlt4_des, 1 hit
SMARTiView protein in SMART
SM01269 Lipid_DES, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q8R2F2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNSAARSDF EWVYSDQPHT QRRKEMLAKY PAIKALMRPD PHIKWTVSGM
60 70 80 90 100
VLVQVLACWL VRGLSWRWLL FWAYAFGGCI NHSLTLAIHD ISHNTAFGTS
110 120 130 140 150
CVSRNRWFAI FANLPIGLPY ATSFKKYHVD HHRYLGGDGL DVDIPTNFEG
160 170 180 190 200
WFFCTPARKL LWLVLQPFFY SLRPLCVNPK VVTRMEILNA LVQLAFDVTI
210 220 230 240 250
FALWGIKPIV YLLGSSLLGL GLHPISGHFV AEHYMFLKGH ETYSYYGPLN
260 270 280 290 300
WITFNVGYHM EHHDFPSIPG YYLPLVRKIA PEYYDHLPQH HSWVKVLWDF
310 320
VFEDSMGPYS RVKRKCKLAK DHL
Length:323
Mass (Da):37,491
Last modified:June 1, 2002 - v1
Checksum:iE5B63884E45B5E16
GO
Isoform 21 Publication (identifier: Q8R2F2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     276-323: VRKIAPEYYDHLPQHHSWVKVLWDFVFEDSMGPYSRVKRKCKLAKDHL → DDWNPVRRDVL

Note: No experimental confirmation available.Curated
Show »
Length:286
Mass (Da):33,020
Checksum:i7FB65936C8D51E22
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1Y7VIS8A0A1Y7VIS8_MOUSE
Sphingolipid delta(4)-desaturase/C4...
Degs2
98Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti88I → T in BAE37145 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_052629276 – 323VRKIA…AKDHL → DDWNPVRRDVL in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF466377 mRNA Translation: AAM12533.1
AK162979 mRNA Translation: BAE37145.1
BC016427 mRNA Translation: AAH16427.2
CCDSiCCDS26162.1 [Q8R2F2-1]
CCDS49170.1 [Q8R2F2-2]
RefSeqiNP_001164473.1, NM_001171002.1 [Q8R2F2-2]
NP_081575.2, NM_027299.5 [Q8R2F2-1]
UniGeneiMm.207605

Genome annotation databases

EnsembliENSMUST00000021691; ENSMUSP00000021691; ENSMUSG00000021263 [Q8R2F2-1]
ENSMUST00000167978; ENSMUSP00000125891; ENSMUSG00000021263 [Q8R2F2-2]
GeneIDi70059
KEGGimmu:70059
UCSCiuc007pab.2 mouse [Q8R2F2-1]
uc011yrv.1 mouse [Q8R2F2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF466377 mRNA Translation: AAM12533.1
AK162979 mRNA Translation: BAE37145.1
BC016427 mRNA Translation: AAH16427.2
CCDSiCCDS26162.1 [Q8R2F2-1]
CCDS49170.1 [Q8R2F2-2]
RefSeqiNP_001164473.1, NM_001171002.1 [Q8R2F2-2]
NP_081575.2, NM_027299.5 [Q8R2F2-1]
UniGeneiMm.207605

3D structure databases

ProteinModelPortaliQ8R2F2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000021691

Chemistry databases

SwissLipidsiSLP:000000168

PTM databases

PhosphoSitePlusiQ8R2F2

Proteomic databases

PaxDbiQ8R2F2
PRIDEiQ8R2F2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021691; ENSMUSP00000021691; ENSMUSG00000021263 [Q8R2F2-1]
ENSMUST00000167978; ENSMUSP00000125891; ENSMUSG00000021263 [Q8R2F2-2]
GeneIDi70059
KEGGimmu:70059
UCSCiuc007pab.2 mouse [Q8R2F2-1]
uc011yrv.1 mouse [Q8R2F2-2]

Organism-specific databases

CTDi123099
MGIiMGI:1917309 Degs2

Phylogenomic databases

eggNOGiKOG2987 Eukaryota
ENOG410XQVT LUCA
GeneTreeiENSGT00390000013448
HOGENOMiHOG000188299
HOVERGENiHBG052775
InParanoidiQ8R2F2
KOiK04712
OMAiPQHHSWV
OrthoDBiEOG091G09NW
PhylomeDBiQ8R2F2
TreeFamiTF313582

Enzyme and pathway databases

UniPathwayi
UPA00786

ReactomeiR-MMU-1660661 Sphingolipid de novo biosynthesis

Miscellaneous databases

PROiPR:Q8R2F2
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021263 Expressed in 95 organ(s), highest expression level in decidua
ExpressionAtlasiQ8R2F2 baseline and differential
GenevisibleiQ8R2F2 MM

Family and domain databases

CDDicd03508 Delta4-sphingolipid-FADS-like, 1 hit
InterProiView protein in InterPro
IPR011388 DES1/DES2
IPR005804 FA_desaturase_dom
IPR013866 Sphingolipid_d4-desaturase_N
PfamiView protein in Pfam
PF00487 FA_desaturase, 1 hit
PF08557 Lipid_DES, 1 hit
PIRSFiPIRSF017228 Sphnglp_dlt4_des, 1 hit
SMARTiView protein in SMART
SM01269 Lipid_DES, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDEGS2_MOUSE
AccessioniPrimary (citable) accession number: Q8R2F2
Secondary accession number(s): Q3TR85, Q78JJ1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 1, 2002
Last modified: September 12, 2018
This is version 118 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again