Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NudC domain-containing protein 3

Gene

Nudcd3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
NudC domain-containing protein 3
Gene namesi
Name:Nudcd3
Synonyms:Kiaa1068
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:2144158 Nudcd3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000579861 – 363NudC domain-containing protein 3Add BLAST363

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei342PhosphoserineBy similarity1
Modified residuei357PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8R1N4
PaxDbiQ8R1N4
PeptideAtlasiQ8R1N4
PRIDEiQ8R1N4

PTM databases

iPTMnetiQ8R1N4
PhosphoSitePlusiQ8R1N4

Expressioni

Gene expression databases

BgeeiENSMUSG00000053838
CleanExiMM_NUDCD3
ExpressionAtlasiQ8R1N4 baseline and differential
GenevisibleiQ8R1N4 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ8R1N4, 1 interactor
STRINGi10090.ENSMUSP00000064668

Structurei

3D structure databases

ProteinModelPortaliQ8R1N4
SMRiQ8R1N4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini187 – 279CSPROSITE-ProRule annotationAdd BLAST93

Phylogenomic databases

eggNOGiKOG2265 Eukaryota
ENOG410XQVU LUCA
GeneTreeiENSGT00530000063486
HOVERGENiHBG100537
InParanoidiQ8R1N4
OMAiQILYGAM
OrthoDBiEOG091G0BZ5
PhylomeDBiQ8R1N4
TreeFamiTF300147

Family and domain databases

CDDicd06495 p23_NUDCD3_like, 1 hit
Gene3Di2.60.40.790, 1 hit
InterProiView protein in InterPro
IPR007052 CS_dom
IPR008978 HSP20-like_chaperone
IPR037898 NudC_fam
IPR025934 NudC_N_dom
IPR027761 NUDCD3
IPR037905 p23_NUDCD3
PANTHERiPTHR12356 PTHR12356, 1 hit
PTHR12356:SF19 PTHR12356:SF19, 1 hit
PfamiView protein in Pfam
PF04969 CS, 1 hit
PF14050 Nudc_N, 1 hit
SUPFAMiSSF49764 SSF49764, 1 hit
PROSITEiView protein in PROSITE
PS51203 CS, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R1N4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPGAAELYD QALLGILQHV GNVQDFLRVL FGFLYRKTDF YRLLRHPSDR
60 70 80 90 100
MGFPPGAAQA LVLQVFKTFD HMARQDDEKR KKELEEKIRK KEEEAKALPA
110 120 130 140 150
AETEKVAVPV PVQEVEIDAA ADLSGPQEVE KEEPPGSQDP EHTVTHGLEK
160 170 180 190 200
AEAPGTVSSA AEGPKDPPVL PRIQEQFQKN PDSYNGAIRE NYIWSQDYTD
210 220 230 240 250
LEVRVPVPKH VMKGKQVSVA LSSGTIRVAM VEENGERVLM EGKLTHKINT
260 270 280 290 300
ESSLWSLEPG RCVLVNLSKV GEYWWSAILE GEEPIDIDKI NKERSMATVD
310 320 330 340 350
EEEQAVLDRL TFDYHQKLQG KPQSHELKVH EMLKKGWDAE GSPFRGQRFD
360
PAMFNISPGA VQF
Length:363
Mass (Da):40,890
Last modified:November 23, 2004 - v3
Checksum:iD5FD1DE3CB724042
GO
Isoform 2 (identifier: Q8R1N4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     217-264: Missing.

Note: No experimental confirmation available.
Show »
Length:315
Mass (Da):35,680
Checksum:i8698CF4A89FCD037
GO
Isoform 3 (identifier: Q8R1N4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-300: NLSKVGEYWWSAILEGEEPIDIDKINKERSMATVD → SEVTCVQSSHQGFAPAMMTCVQVFPIISEVFNYSN
     301-363: Missing.

Note: No experimental confirmation available.
Show »
Length:300
Mass (Da):33,422
Checksum:i78332B8FE99AF53F
GO
Isoform 4 (identifier: Q8R1N4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-295: Missing.

Note: No experimental confirmation available.
Show »
Length:68
Mass (Da):7,819
Checksum:iA425E792241C7233
GO

Sequence cautioni

The sequence BAC98086 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0136771 – 295Missing in isoform 4. 1 PublicationAdd BLAST295
Alternative sequenceiVSP_013678217 – 264Missing in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_013679266 – 300NLSKV…MATVD → SEVTCVQSSHQGFAPAMMTC VQVFPIISEVFNYSN in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_013680301 – 363Missing in isoform 3. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129276 mRNA Translation: BAC98086.1 Different initiation.
AK046219 mRNA Translation: BAC32642.1
AK049739 mRNA Translation: BAC33899.1
AK050476 mRNA Translation: BAC34277.1
AK159391 mRNA Translation: BAE35045.1
AK159458 mRNA Translation: BAE35100.1
AK169797 mRNA Translation: BAE41373.1
AK170329 mRNA Translation: BAE41723.1
AK171224 mRNA Translation: BAE42326.1
AL607152, AL611926 Genomic DNA Translation: CAI24394.1
AL611926, AL607152 Genomic DNA Translation: CAI24956.1
AL611926 Genomic DNA Translation: CAI24961.1
BC024322 mRNA Translation: AAH24322.3
BC037090 mRNA Translation: AAH37090.1
BC057603 mRNA Translation: AAH57603.1
CCDSiCCDS24412.1 [Q8R1N4-1]
RefSeqiNP_776109.1, NM_173748.4 [Q8R1N4-1]
XP_006514666.1, XM_006514603.2 [Q8R1N4-2]
UniGeneiMm.25321
Mm.472975

Genome annotation databases

EnsembliENSMUST00000066496; ENSMUSP00000064668; ENSMUSG00000053838 [Q8R1N4-1]
GeneIDi209586
KEGGimmu:209586
UCSCiuc007hxy.2 mouse [Q8R1N4-1]
uc007hxz.2 mouse [Q8R1N4-2]
uc007hya.2 mouse [Q8R1N4-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNUDC3_MOUSE
AccessioniPrimary (citable) accession number: Q8R1N4
Secondary accession number(s): Q3TX16
, Q5SVV6, Q5SVV7, Q6PFE4, Q6ZPZ2, Q8BL70, Q8BWN3, Q8BWW5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: November 23, 2004
Last modified: February 28, 2018
This is version 113 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health