Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CDK2-associated and cullin domain-containing protein 1

Gene

Cacul1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Cell cycle associated protein capable of promoting cell proliferation through the activation of CDK2 at the G1/S phase transition.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processCell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
CDK2-associated and cullin domain-containing protein 1
Gene namesi
Name:Cacul1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:1926082 Cacul1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001198181 – 377CDK2-associated and cullin domain-containing protein 1Add BLAST377

Proteomic databases

EPDiQ8R0X2
PaxDbiQ8R0X2
PeptideAtlasiQ8R0X2
PRIDEiQ8R0X2

PTM databases

iPTMnetiQ8R0X2
PhosphoSitePlusiQ8R0X2

Expressioni

Gene expression databases

BgeeiENSMUSG00000033417 Expressed in 289 organ(s), highest expression level in testis
CleanExiMM_2700078E11RIK
ExpressionAtlasiQ8R0X2 baseline and differential
GenevisibleiQ8R0X2 MM

Interactioni

Subunit structurei

Interacts with CDK2.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000080480

Structurei

3D structure databases

ProteinModelPortaliQ8R0X2
SMRiQ8R0X2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi35 – 92Pro-richAdd BLAST58
Compositional biasi104 – 109Poly-Ala6

Sequence similaritiesi

Belongs to the cullin family.Curated

Phylogenomic databases

eggNOGiKOG2166 Eukaryota
COG5647 LUCA
GeneTreeiENSGT00390000000403
HOGENOMiHOG000111684
HOVERGENiHBG059519
InParanoidiQ8R0X2
OMAiWVQMAPA
OrthoDBiEOG091G0EJ6
PhylomeDBiQ8R0X2
TreeFamiTF329263

Family and domain databases

InterProiView protein in InterPro
IPR001373 Cullin_N
IPR016159 Cullin_repeat-like_dom_sf
PfamiView protein in Pfam
PF00888 Cullin, 1 hit
SUPFAMiSSF74788 SSF74788, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8R0X2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEESMEEEEM LTYEAMMDDQ NHNNWEAAAD SFRQPPPAPP LPPPPPPRPS
60 70 80 90 100
SSIPDPGREL PGGQLLAVHA GSMERKGPKE GLPMGPPPLP EPNGVIMMLK
110 120 130 140 150
SCDAAAAVAK TAPAPTSSST ININTSTSKF LMNVITIEDY KSTYWPKLDG
160 170 180 190 200
AIDQLLTQSP GDYIPISYEQ IYSCVYKCVC QQHSEQMYSD LIKKITSHLE
210 220 230 240 250
RVSKELQASP PDLYIERFNI ALGQYMGALQ SIVPLFIYMN KFYIETKLNR
260 270 280 290 300
DLKDDLIKLF TEHVAEKHIY SLMPLLLEAQ STPFQVTPST MANIVKGLYT
310 320 330 340 350
LRPEWVQMAP TLFSKFIPNI LPPAVESELS EYAAQDQKLQ RELIQNGFTR
360 370
GDQSRKRAGD ELAYNSPSAC ASSRGYR
Length:377
Mass (Da):42,106
Last modified:June 1, 2002 - v1
Checksum:i1BBF30D5394FE381
GO
Isoform 2 (identifier: Q8R0X2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     274-304: PLLLEAQSTPFQVTPSTMANIVKGLYTLRPE → QVISPGRELEMSWLITVHLLVQVPGGIDSDG
     305-377: Missing.

Show »
Length:304
Mass (Da):33,864
Checksum:iDEB742C6FBE7EE7D
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PV69E9PV69_MOUSE
CDK2-associated and cullin domain-c...
Cacul1 2700078E11Rik
347Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013938274 – 304PLLLE…TLRPE → QVISPGRELEMSWLITVHLL VQVPGGIDSDG in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_013939305 – 377Missing in isoform 2. 1 PublicationAdd BLAST73

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019216 mRNA Translation: BAB31607.1
AK147382 mRNA Translation: BAE27876.1
AK169791 mRNA Translation: BAE41369.1
BC026363 mRNA Translation: AAH26363.1
CCDSiCCDS38034.1 [Q8R0X2-1]
CCDS50483.1 [Q8R0X2-2]
RefSeqiNP_001165567.1, NM_001172096.1
NP_001165568.1, NM_001172097.1 [Q8R0X2-2]
NP_084473.1, NM_030197.2 [Q8R0X2-1]
UniGeneiMm.259026
Mm.447781
Mm.471362

Genome annotation databases

EnsembliENSMUST00000081790; ENSMUSP00000080480; ENSMUSG00000033417 [Q8R0X2-1]
ENSMUST00000111460; ENSMUSP00000107086; ENSMUSG00000033417 [Q8R0X2-2]
GeneIDi78832
KEGGimmu:78832
UCSCiuc008ibv.2 mouse [Q8R0X2-1]
uc012bof.1 mouse [Q8R0X2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019216 mRNA Translation: BAB31607.1
AK147382 mRNA Translation: BAE27876.1
AK169791 mRNA Translation: BAE41369.1
BC026363 mRNA Translation: AAH26363.1
CCDSiCCDS38034.1 [Q8R0X2-1]
CCDS50483.1 [Q8R0X2-2]
RefSeqiNP_001165567.1, NM_001172096.1
NP_001165568.1, NM_001172097.1 [Q8R0X2-2]
NP_084473.1, NM_030197.2 [Q8R0X2-1]
UniGeneiMm.259026
Mm.447781
Mm.471362

3D structure databases

ProteinModelPortaliQ8R0X2
SMRiQ8R0X2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000080480

PTM databases

iPTMnetiQ8R0X2
PhosphoSitePlusiQ8R0X2

Proteomic databases

EPDiQ8R0X2
PaxDbiQ8R0X2
PeptideAtlasiQ8R0X2
PRIDEiQ8R0X2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000081790; ENSMUSP00000080480; ENSMUSG00000033417 [Q8R0X2-1]
ENSMUST00000111460; ENSMUSP00000107086; ENSMUSG00000033417 [Q8R0X2-2]
GeneIDi78832
KEGGimmu:78832
UCSCiuc008ibv.2 mouse [Q8R0X2-1]
uc012bof.1 mouse [Q8R0X2-2]

Organism-specific databases

CTDi143384
MGIiMGI:1926082 Cacul1

Phylogenomic databases

eggNOGiKOG2166 Eukaryota
COG5647 LUCA
GeneTreeiENSGT00390000000403
HOGENOMiHOG000111684
HOVERGENiHBG059519
InParanoidiQ8R0X2
OMAiWVQMAPA
OrthoDBiEOG091G0EJ6
PhylomeDBiQ8R0X2
TreeFamiTF329263

Miscellaneous databases

PROiPR:Q8R0X2
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000033417 Expressed in 289 organ(s), highest expression level in testis
CleanExiMM_2700078E11RIK
ExpressionAtlasiQ8R0X2 baseline and differential
GenevisibleiQ8R0X2 MM

Family and domain databases

InterProiView protein in InterPro
IPR001373 Cullin_N
IPR016159 Cullin_repeat-like_dom_sf
PfamiView protein in Pfam
PF00888 Cullin, 1 hit
SUPFAMiSSF74788 SSF74788, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCACL1_MOUSE
AccessioniPrimary (citable) accession number: Q8R0X2
Secondary accession number(s): Q3TE79, Q9CY95
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 1, 2002
Last modified: November 7, 2018
This is version 116 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again