Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 125 (12 Aug 2020)
Sequence version 1 (01 Jun 2002)
Previous versions | rss
Add a publicationFeedback
Protein

CDK2-associated and cullin domain-containing protein 1

Gene

Cacul1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell cycle associated protein capable of promoting cell proliferation through the activation of CDK2 at the G1/S phase transition.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CDK2-associated and cullin domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cacul1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1926082, Cacul1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001198181 – 377CDK2-associated and cullin domain-containing protein 1Add BLAST377

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8R0X2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8R0X2

PeptideAtlas

More...
PeptideAtlasi
Q8R0X2

PRoteomics IDEntifications database

More...
PRIDEi
Q8R0X2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8R0X2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8R0X2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000033417, Expressed in testis and 303 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8R0X2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8R0X2, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CDK2.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000080480

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8R0X2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8R0X2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi35 – 92Pro-richAdd BLAST58
Compositional biasi104 – 109Poly-Ala6

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cullin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2166, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000403

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_062250_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8R0X2

Identification of Orthologs from Complete Genome Data

More...
OMAi
MQNGFTR

Database of Orthologous Groups

More...
OrthoDBi
991620at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8R0X2

TreeFam database of animal gene trees

More...
TreeFami
TF329263

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR042652, CACUL1
IPR001373, Cullin_N
IPR016159, Cullin_repeat-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR46636, PTHR46636, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00888, Cullin, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF74788, SSF74788, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8R0X2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEESMEEEEM LTYEAMMDDQ NHNNWEAAAD SFRQPPPAPP LPPPPPPRPS
60 70 80 90 100
SSIPDPGREL PGGQLLAVHA GSMERKGPKE GLPMGPPPLP EPNGVIMMLK
110 120 130 140 150
SCDAAAAVAK TAPAPTSSST ININTSTSKF LMNVITIEDY KSTYWPKLDG
160 170 180 190 200
AIDQLLTQSP GDYIPISYEQ IYSCVYKCVC QQHSEQMYSD LIKKITSHLE
210 220 230 240 250
RVSKELQASP PDLYIERFNI ALGQYMGALQ SIVPLFIYMN KFYIETKLNR
260 270 280 290 300
DLKDDLIKLF TEHVAEKHIY SLMPLLLEAQ STPFQVTPST MANIVKGLYT
310 320 330 340 350
LRPEWVQMAP TLFSKFIPNI LPPAVESELS EYAAQDQKLQ RELIQNGFTR
360 370
GDQSRKRAGD ELAYNSPSAC ASSRGYR
Length:377
Mass (Da):42,106
Last modified:June 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1BBF30D5394FE381
GO
Isoform 2 (identifier: Q8R0X2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     274-304: PLLLEAQSTPFQVTPSTMANIVKGLYTLRPE → QVISPGRELEMSWLITVHLLVQVPGGIDSDG
     305-377: Missing.

Show »
Length:304
Mass (Da):33,864
Checksum:iDEB742C6FBE7EE7D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PV69E9PV69_MOUSE
CDK2-associated and cullin domain-c...
Cacul1 2700078E11Rik
347Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013938274 – 304PLLLE…TLRPE → QVISPGRELEMSWLITVHLL VQVPGGIDSDG in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_013939305 – 377Missing in isoform 2. 1 PublicationAdd BLAST73

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK019216 mRNA Translation: BAB31607.1
AK147382 mRNA Translation: BAE27876.1
AK169791 mRNA Translation: BAE41369.1
BC026363 mRNA Translation: AAH26363.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS38034.1 [Q8R0X2-1]
CCDS50483.1 [Q8R0X2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001165567.1, NM_001172096.1
NP_001165568.1, NM_001172097.1 [Q8R0X2-2]
NP_084473.1, NM_030197.2 [Q8R0X2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000081790; ENSMUSP00000080480; ENSMUSG00000033417 [Q8R0X2-1]
ENSMUST00000111460; ENSMUSP00000107086; ENSMUSG00000033417 [Q8R0X2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
78832

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:78832

UCSC genome browser

More...
UCSCi
uc008ibv.2, mouse [Q8R0X2-1]
uc012bof.1, mouse [Q8R0X2-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019216 mRNA Translation: BAB31607.1
AK147382 mRNA Translation: BAE27876.1
AK169791 mRNA Translation: BAE41369.1
BC026363 mRNA Translation: AAH26363.1
CCDSiCCDS38034.1 [Q8R0X2-1]
CCDS50483.1 [Q8R0X2-2]
RefSeqiNP_001165567.1, NM_001172096.1
NP_001165568.1, NM_001172097.1 [Q8R0X2-2]
NP_084473.1, NM_030197.2 [Q8R0X2-1]

3D structure databases

SMRiQ8R0X2
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000080480

PTM databases

iPTMnetiQ8R0X2
PhosphoSitePlusiQ8R0X2

Proteomic databases

EPDiQ8R0X2
PaxDbiQ8R0X2
PeptideAtlasiQ8R0X2
PRIDEiQ8R0X2

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
32069, 135 antibodies

Genome annotation databases

EnsembliENSMUST00000081790; ENSMUSP00000080480; ENSMUSG00000033417 [Q8R0X2-1]
ENSMUST00000111460; ENSMUSP00000107086; ENSMUSG00000033417 [Q8R0X2-2]
GeneIDi78832
KEGGimmu:78832
UCSCiuc008ibv.2, mouse [Q8R0X2-1]
uc012bof.1, mouse [Q8R0X2-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
143384
MGIiMGI:1926082, Cacul1

Phylogenomic databases

eggNOGiKOG2166, Eukaryota
GeneTreeiENSGT00390000000403
HOGENOMiCLU_062250_1_0_1
InParanoidiQ8R0X2
OMAiMQNGFTR
OrthoDBi991620at2759
PhylomeDBiQ8R0X2
TreeFamiTF329263

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
78832, 5 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Cacul1, mouse

Protein Ontology

More...
PROi
PR:Q8R0X2
RNActiQ8R0X2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000033417, Expressed in testis and 303 other tissues
ExpressionAtlasiQ8R0X2, baseline and differential
GenevisibleiQ8R0X2, MM

Family and domain databases

InterProiView protein in InterPro
IPR042652, CACUL1
IPR001373, Cullin_N
IPR016159, Cullin_repeat-like_dom_sf
PANTHERiPTHR46636, PTHR46636, 1 hit
PfamiView protein in Pfam
PF00888, Cullin, 1 hit
SUPFAMiSSF74788, SSF74788, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCACL1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8R0X2
Secondary accession number(s): Q3TE79, Q9CY95
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 1, 2002
Last modified: August 12, 2020
This is version 125 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again