Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 124 (12 Aug 2020)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Testis anion transporter 1

Gene

Slc26a8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a DIDS-sensitive anion exchanger mediating chloride, sulfate and oxalate transport. May fulfill critical anion exchange functions in male germ line during meiosis and hence may play a role in spermatogenesis. May be involved in a new regulatory pathway linking sulfate transport to RhoGTPase signaling in male germ cells. A critical component of the sperm annulus that is essential for correct sperm tail differentiation and motility and hence male fertility. May form a molecular complex involved in the regulation of chloride and bicarbonate ions fluxes during sperm capacitation (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processAnion exchange, Differentiation, Ion transport, Meiosis, Spermatogenesis, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Testis anion transporter 1
Alternative name(s):
Anion exchange transporter
Solute carrier family 26 member 8
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc26a8Imported
Synonyms:Tat11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2385046, Slc26a8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 93CytoplasmicSequence analysisAdd BLAST93
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei94 – 114HelicalSequence analysisAdd BLAST21
Topological domaini115 – 117ExtracellularSequence analysis3
Transmembranei118 – 138HelicalSequence analysisAdd BLAST21
Topological domaini139CytoplasmicSequence analysis1
Transmembranei140 – 160HelicalSequence analysisAdd BLAST21
Topological domaini161 – 200ExtracellularSequence analysisAdd BLAST40
Transmembranei201 – 221HelicalSequence analysisAdd BLAST21
Topological domaini222 – 230CytoplasmicSequence analysis9
Transmembranei231 – 251HelicalSequence analysisAdd BLAST21
Topological domaini252 – 268ExtracellularSequence analysisAdd BLAST17
Transmembranei269 – 289HelicalSequence analysisAdd BLAST21
Topological domaini290 – 305CytoplasmicSequence analysisAdd BLAST16
Transmembranei306 – 326HelicalSequence analysisAdd BLAST21
Topological domaini327 – 354ExtracellularSequence analysisAdd BLAST28
Transmembranei355 – 375HelicalSequence analysisAdd BLAST21
Topological domaini376 – 390CytoplasmicSequence analysisAdd BLAST15
Transmembranei391 – 411HelicalSequence analysisAdd BLAST21
Topological domaini412 – 427ExtracellularSequence analysisAdd BLAST16
Transmembranei428 – 448HelicalSequence analysisAdd BLAST21
Topological domaini449 – 453CytoplasmicSequence analysis5
Transmembranei454 – 474HelicalSequence analysisAdd BLAST21
Topological domaini475 – 494ExtracellularSequence analysisAdd BLAST20
Transmembranei495 – 515HelicalSequence analysisAdd BLAST21
Topological domaini516 – 544CytoplasmicSequence analysisAdd BLAST29
Transmembranei545 – 565HelicalSequence analysisAdd BLAST21
Topological domaini566 – 999ExtracellularSequence analysisAdd BLAST434

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Sperm lacks motility and displayed a capacitation defect, with reduced cAMP concentration due to misactivation of soluble adenylate cyclase (see Adcy1).1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003225881 – 999Testis anion transporter 1Add BLAST999

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi190N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8R0C3

PRoteomics IDEntifications database

More...
PRIDEi
Q8R0C3

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8R0C3, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8R0C3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8R0C3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in testis and epididymis. Located at the end of the midpiece of the flagella, known as the annulus, in spermatozoa.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000036196, Expressed in spermatocyte and 137 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8R0C3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8R0C3, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RACGAP1.

Interacts with CFTR.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
230299, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8R0C3, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000110412

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8R0C3, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini541 – 796STASPROSITE-ProRule annotationAdd BLAST256

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni661 – 999Interaction with RACGAP1By similarityAdd BLAST339

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi900 – 952Glu-richSequence analysisAdd BLAST53

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0236, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT01000000214410

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003182_9_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8R0C3

KEGG Orthology (KO)

More...
KOi
K14705

Identification of Orthologs from Complete Genome Data

More...
OMAi
CYCNCDE

Database of Orthologous Groups

More...
OrthoDBi
289441at2759

TreeFam database of animal gene trees

More...
TreeFami
TF313784

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011547, SLC26A/SulP_dom
IPR001902, SLC26A/SulP_fam
IPR030303, SLC26A8
IPR002645, STAS_dom
IPR036513, STAS_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11814, PTHR11814, 1 hit
PTHR11814:SF11, PTHR11814:SF11, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01740, STAS, 1 hit
PF00916, Sulfate_transp, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52091, SSF52091, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50801, STAS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8R0C3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQTERSLQSF SNRYTQIPFV YDVKRSVYNE ENFQQEHRKK GPTSGNVDID
60 70 80 90 100
ITTFKHHVQC GCSWHKFLRC MLTVFPFLEW ICLYRFKDWL LGDLLAGLSV
110 120 130 140 150
GLVQVPQGLI LSLLTRQLIP PLNVTYAAFC SSVIYVIFGS CHQMSIGPFF
160 170 180 190 200
LVSALMINVL KDRPFNNGHL ILGTFVKDDF SVPTFYLSYN RSLSMVASTT
210 220 230 240 250
FLTGIIQLSM GMLGMGFMAT YLPEAATSAY LAAVALHIIL AQMTCILGIM
260 270 280 290 300
VSFHAGPISF IYNIINYCIA LPKANSTSIL LFITSVVALR INKCIRITFN
310 320 330 340 350
RYPIEFPMEL LLILGFSLLT SKITMATENS KMLMNMIPYS FVFPENPEFG
360 370 380 390 400
ILSRVVLQAL SLSFVSSFLL ISLGKKIANF HNYRTNSNQD LIAIGLCNLL
410 420 430 440 450
SSFFKCCVFT GSLSRTTIQD KSGGRQQFAS LVGAGVMLLL MVKMESFFHN
460 470 480 490 500
LPNAVLAGII LSNVVPYLEA IYNLPSLWRQ DQYECIIWMV TFSSAILLGL
510 520 530 540 550
DVGLLISLAF TFFVITIRSH RTKILVLGQI PNTNIYRNVN DYREVILIPG
560 570 580 590 600
VKIFQCCSSI TFVNVYHLKQ KVLKEVNMVK LPLKEEEIYT LFHESETSIA
610 620 630 640 650
ENKLCRCFCD CEELEPEIRV VYTERYENRQ EQDSSINLIR CSYLGSGDSS
660 670 680 690 700
QVTSEEQIPY TVSSTSQRNI VQSYEDTEKA WLPNSPPRNS PLPPPEASES
710 720 730 740 750
LAQSRSRSII MPYSDTSVQN NTHTIILDFS MVHYVDNRAL VILRQMCNAF
760 770 780 790 800
YNANILVLIS GCHTSVVKSF EKNDFFDEGI TKAQLFLSLH DAVLFALSRK
810 820 830 840 850
FSEPSDLSMD ETETVIQETY SESDKNGNLS NLRLKTGKAI IEGSQHASPG
860 870 880 890 900
FTKNLKPGKD DLEFDLELDP MLSFEQSSGM DLNLDLDLDL DQSELDPGSE
910 920 930 940 950
LDSEIQAKPE LELESELETD AQTEPETEEE PELEPEPEPE PETEPEPEPE
960 970 980 990
RERKTRTRSQ SPWRNYFTAY RFGSSNSQSR APPQTRPEKR KPHNYPNSP
Length:999
Mass (Da):112,978
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2664974E42D4996D
GO
Isoform 21 Publication (identifier: Q8R0C3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     486-521: IIWMVTFSSAILLGLDVGLLISLAFTFFVITIRSHR → VSTDASSGCNLGVRGAEAHTHTLPHGQFPGLDPWGQ
     522-999: Missing.

Note: Due to a partial intron retention.Curated
Show »
Length:521
Mass (Da):58,127
Checksum:iE95BB4870BAEEDF6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B2WCZ8A0A3B2WCZ8_MOUSE
Testis anion transporter 1
Slc26a8
894Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B2W7R5A0A3B2W7R5_MOUSE
Testis anion transporter 1
Slc26a8
252Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B2WD00A0A3B2WD00_MOUSE
Testis anion transporter 1
Slc26a8
430Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B2W7P2A0A3B2W7P2_MOUSE
Testis anion transporter 1
Slc26a8
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_052702486 – 521IIWMV…IRSHR → VSTDASSGCNLGVRGAEAHT HTLPHGQFPGLDPWGQ in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_052703522 – 999Missing in isoform 2. 1 PublicationAdd BLAST478

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC170998 Genomic DNA No translation available.
BC027076 mRNA Translation: AAH27076.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS70779.1 [Q8R0C3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001277249.1, NM_001290320.1 [Q8R0C3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000114764; ENSMUSP00000110412; ENSMUSG00000036196 [Q8R0C3-1]
ENSMUST00000145224; ENSMUSP00000156853; ENSMUSG00000036196 [Q8R0C3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
224661

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:224661

UCSC genome browser

More...
UCSCi
uc008brk.1, mouse [Q8R0C3-2]
uc056zdz.1, mouse [Q8R0C3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC170998 Genomic DNA No translation available.
BC027076 mRNA Translation: AAH27076.1 Sequence problems.
CCDSiCCDS70779.1 [Q8R0C3-1]
RefSeqiNP_001277249.1, NM_001290320.1 [Q8R0C3-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi230299, 2 interactors
IntActiQ8R0C3, 1 interactor
STRINGi10090.ENSMUSP00000110412

PTM databases

GlyGeniQ8R0C3, 1 site
iPTMnetiQ8R0C3
PhosphoSitePlusiQ8R0C3

Proteomic databases

PaxDbiQ8R0C3
PRIDEiQ8R0C3

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29584, 94 antibodies

Genome annotation databases

EnsembliENSMUST00000114764; ENSMUSP00000110412; ENSMUSG00000036196 [Q8R0C3-1]
ENSMUST00000145224; ENSMUSP00000156853; ENSMUSG00000036196 [Q8R0C3-2]
GeneIDi224661
KEGGimmu:224661
UCSCiuc008brk.1, mouse [Q8R0C3-2]
uc056zdz.1, mouse [Q8R0C3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
116369
MGIiMGI:2385046, Slc26a8

Phylogenomic databases

eggNOGiKOG0236, Eukaryota
GeneTreeiENSGT01000000214410
HOGENOMiCLU_003182_9_3_1
InParanoidiQ8R0C3
KOiK14705
OMAiCYCNCDE
OrthoDBi289441at2759
TreeFamiTF313784

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
224661, 0 hits in 8 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Slc26a8, mouse

Protein Ontology

More...
PROi
PR:Q8R0C3
RNActiQ8R0C3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000036196, Expressed in spermatocyte and 137 other tissues
ExpressionAtlasiQ8R0C3, baseline and differential
GenevisibleiQ8R0C3, MM

Family and domain databases

InterProiView protein in InterPro
IPR011547, SLC26A/SulP_dom
IPR001902, SLC26A/SulP_fam
IPR030303, SLC26A8
IPR002645, STAS_dom
IPR036513, STAS_dom_sf
PANTHERiPTHR11814, PTHR11814, 1 hit
PTHR11814:SF11, PTHR11814:SF11, 1 hit
PfamiView protein in Pfam
PF01740, STAS, 1 hit
PF00916, Sulfate_transp, 1 hit
SUPFAMiSSF52091, SSF52091, 1 hit
PROSITEiView protein in PROSITE
PS50801, STAS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS26A8_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8R0C3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: August 12, 2020
This is version 124 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again