Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8NI51 (CTCFL_HUMAN)

Entry version 164 (11 Dec 2019)
Sequence version 2 (30 Nov 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transcriptional repressor CTCFL

Gene

CTCFL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. This probably leads to recruit de novo DNA methyltransferases at these sites (By similarity). Seems to act as tumor suppressor. In association with DNMT1 and DNMT3B, involved in activation of BAG1 gene expression by binding to its promoter. Required for dimethylation of H3 lysine 4 (H3K4me2) of MYC and BRCA1 promoters.By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri257 – 279C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri285 – 307C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri313 – 336C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri342 – 364C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 392C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri398 – 421C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri428 – 451C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri458 – 480C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri486 – 508C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri514 – 537C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri546 – 568C2H2-type 11; atypicalPROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Chromatin regulator, DNA-binding, Repressor
Biological processCell cycle, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q8NI51

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q8NI51

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcriptional repressor CTCFL
Alternative name(s):
Brother of the regulator of imprinted sites
CCCTC-binding factor
CTCF paralog
CTCF-like protein
Cancer/testis antigen 27
Short name:
CT27
Zinc finger protein CTCF-T
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CTCFL
Synonyms:BORIS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000124092.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:16234 CTCFL

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607022 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NI51

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		140690

Open Targets

More...OpenTargetsi		ENSG00000124092

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26999

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NI51 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CTCFL

Domain mapping of disease mutations (DMDM)

More...DMDMi		313104098

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000472261 – 663Transcriptional repressor CTCFLAdd BLAST663

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8NI51

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NI51

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8NI51

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NI51

PeptideAtlas

More...PeptideAtlasi		Q8NI51

PRoteomics IDEntifications database

More...PRIDEi		Q8NI51

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		1764
1765
1766
1767
1768
1769
1770
18412
73832 [Q8NI51-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NI51

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NI51

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Testis specific. Specifically expressed in primary spermatocytes.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Is up-regulated in primary spermatocytes (expression overlapping with the genome-wide erasure of methylation) to become silenced on activation of CTCF in post-meiotic germline cells (expression corresponding to DNA remethylation).

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000124092 Expressed in 34 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8NI51 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NI51 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA001472

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with histones, PRMT7 and SETD1A.

Interacts (via N-terminus) with BAG6/BAT3.

1 Publication

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		126653, 11 interactors

Protein interaction database and analysis system

More...IntActi		Q8NI51, 15 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000415579

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NI51 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8NI51

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CTCF zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri257 – 279C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri285 – 307C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri313 – 336C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri342 – 364C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 392C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri398 – 421C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri428 – 451C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri458 – 480C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri486 – 508C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri514 – 537C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri546 – 568C2H2-type 11; atypicalPROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161524

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000276534

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NI51

Identification of Orthologs from Complete Genome Data

More...OMAi		TICEYSS

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NI51

TreeFam database of animal gene trees

More...TreeFami		TF106430

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00096 zf-C2H2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00355 ZnF_C2H2, 11 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57667 SSF57667, 7 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 7 hits
PS50157 ZINC_FINGER_C2H2_2, 11 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (11+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 11 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 11 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NI51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAATEISVLS EQFTKIKELE LMPEKGLKEE EKDGVCREKD HRSPSELEAE 
        60         70         80         90        100
RTSGAFQDSV LEEEVELVLA PSEESEKYIL TLQTVHFTSE AVELQDMSLL 
       110        120        130        140        150
SIQQQEGVQV VVQQPGPGLL WLEEGPRQSL QQCVAISIQQ ELYSPQEMEV 
       160        170        180        190        200
LQFHALEENV MVASEDSKLA VSLAETTGLI KLEEEQEKNQ LLAERTKEQL 
       210        220        230        240        250
FFVETMSGDE RSDEIVLTVS NSNVEEQEDQ PTAGQADAEK AKSTKNQRKT 
       260        270        280        290        300
KGAKGTFHCD VCMFTSSRMS SFNRHMKTHT SEKPHLCHLC LKTFRTVTLL 
       310        320        330        340        350
RNHVNTHTGT RPYKCNDCNM AFVTSGELVR HRRYKHTHEK PFKCSMCKYA 
       360        370        380        390        400
SVEASKLKRH VRSHTGERPF QCCQCSYASR DTYKLKRHMR THSGEKPYEC 
       410        420        430        440        450
HICHTRFTQS GTMKIHILQK HGENVPKYQC PHCATIIARK SDLRVHMRNL 
       460        470        480        490        500
HAYSAAELKC RYCSAVFHER YALIQHQKTH KNEKRFKCKH CSYACKQERH 
       510        520        530        540        550
MTAHIRTHTG EKPFTCLSCN KCFRQKQLLN AHFRKYHDAN FIPTVYKCSK 
       560        570        580        590        600
CGKGFSRWIN LHRHSEKCGS GEAKSAASGK GRRTRKRKQT ILKEATKGQK 
       610        620        630        640        650
EAAKGWKEAA NGDEAAAEEA STTKGEQFPG EMFPVACRET TARVKEEVDE 
       660 
GVTCEMLLNT MDK
Length:663
Mass (Da):75,747
Last modified:November 30, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9351E1A85173D085
GO
Isoform 2 (identifier: Q8NI51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     560-663: NLHRHSEKCG...CEMLLNTMDK → TSKWSGLKPQTFIT

Show »
Length:573
Mass (Da):66,029
Checksum:i79DFEA839B95D94B
GO
Isoform 3 (identifier: Q8NI51-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:665
Mass (Da):75,836
Checksum:i322DE1AF4BD6328E
GO
Isoform 4 (identifier: Q8NI51-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-497: Missing.
     560-663: NLHRHSEKCG...CEMLLNTMDK → LWVGNSEVAE...LLQGPLCRAA

Show »
Length:483
Mass (Da):54,194
Checksum:iAA920F461EC5A901
GO
Isoform 5 (identifier: Q8NI51-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
     560-663: NLHRHSEKCG...CEMLLNTMDK → LWVGNSEVAE...LLQGPLCRAA

Show »
Length:422
Mass (Da):48,088
Checksum:i363AC9455A24D686
GO
Isoform 6 (identifier: Q8NI51-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:403
Mass (Da):46,538
Checksum:i141E4AFDF4B5BC2E
GO
Isoform 7 (identifier: Q8NI51-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     663-663: K → NSAGCTGRMMLVSAWLLGRPQETYNQGRRRRGSRRVTW

Show »
Length:700
Mass (Da):80,010
Checksum:iC5ECEB4A1EFA816F
GO
Isoform 8 (identifier: Q8NI51-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     395-444: Missing.

Show »
Length:613
Mass (Da):69,916
Checksum:i4192478A258CB6A1
GO
Isoform 9 (identifier: Q8NI51-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-427: GEKPYECHICHTRFTQSGTMKIHILQKHGENVPK → EATSKRSLQEIPRCKFHPDCLQMLQVWQRLFPLD
     428-663: Missing.

Show »
Length:427
Mass (Da):48,929
Checksum:iAF3D08C4C3250FAA
GO
Isoform 10 (identifier: Q8NI51-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:460
Mass (Da):52,690
Checksum:i55F8D2CC9872A225
GO
Isoform 11 (identifier: Q8NI51-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     559-663: INLHRHSEKC...CEMLLNTMDK → VLY

Show »
Length:299
Mass (Da):35,417
Checksum:i15FF2AEC96221604
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GY73V9GY73_HUMAN
Transcriptional repressor CTCFL
CTCFL
627Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GYX4V9GYX4_HUMAN
Transcriptional repressor CTCFL
CTCFL
404Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H2V8F5H2V8_HUMAN
Transcriptional repressor CTCFL
CTCFL
451Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GZ46V9GZ46_HUMAN
Transcriptional repressor CTCFL
CTCFL
426Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti613Missing in AAL61541 (PubMed:17048991).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02321350E → Q. Corresponds to variant dbSNP:rs6070128Ensembl.1
Natural variantiVAR_023214177T → A4 PublicationsCorresponds to variant dbSNP:rs6025606Ensembl.1
Natural variantiVAR_057374448R → H. Corresponds to variant dbSNP:rs6092491Ensembl.1
Natural variantiVAR_032766525Q → E. Corresponds to variant dbSNP:rs6070122Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451551 – 262Missing in isoform 6 and isoform 11. 1 PublicationAdd BLAST262
Alternative sequenceiVSP_0451561 – 205Missing in isoform 5 and isoform 10. 1 PublicationAdd BLAST205
Alternative sequenceiVSP_045157354 – 497Missing in isoform 4. 1 PublicationAdd BLAST144
Alternative sequenceiVSP_047725394 – 427GEKPY…ENVPK → EATSKRSLQEIPRCKFHPDC LQMLQVWQRLFPLD in isoform 9. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_047058395 – 444Missing in isoform 8. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_047726428 – 663Missing in isoform 9. 1 PublicationAdd BLAST236
Alternative sequenceiVSP_054899559 – 663INLHR…NTMDK → VLY in isoform 11. 1 PublicationAdd BLAST105
Alternative sequenceiVSP_045158560 – 663NLHRH…NTMDK → TSKWSGLKPQTFIT in isoform 2. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_045159560 – 663NLHRH…NTMDK → LWVGNSEVAELGGPGSGPLL RLQSGCPPGLHHPKAGLGPE DPLPGQLRHTTAGTGLSSLL QGPLCRAA in isoform 4 and isoform 5. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_045160614 – 663EAAAE…NTMDK → GVISAHRNLCLLGSSDSHAS VSGAGITDARHHAWLIVLLF LVEMGFYHVSHS in isoform 3, isoform 6 and isoform 10. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_047059663K → NSAGCTGRMMLVSAWLLGRP QETYNQGRRRRGSRRVTW in isoform 7. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF336042 mRNA Translation: AAM28645.1
AY071919 mRNA Translation: AAL61541.1
DQ294738 mRNA Translation: ABB92839.1
DQ778124 mRNA Translation: ABH10106.1
DQ778108 mRNA Translation: ABH10090.1
DQ778109 mRNA Translation: ABH10091.1
DQ778110 mRNA Translation: ABH10092.1
DQ778111 mRNA Translation: ABH10093.1
DQ778112 mRNA Translation: ABH10094.1
DQ778115 mRNA Translation: ABH10097.1
DQ778116 mRNA Translation: ABH10098.1
DQ778121 mRNA Translation: ABH10103.2
DQ778123 mRNA Translation: ABH10105.1
DQ778125 mRNA Translation: ABH10107.2
DQ778126 mRNA Translation: ABH10108.1
DQ778127 mRNA Translation: ABH10109.1
AK128070 mRNA Translation: BAG54626.1
AL035541 Genomic DNA No translation available.
AL160176 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75518.1
BC130486 mRNA Translation: AAI30487.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13459.1 [Q8NI51-1]
CCDS58776.1 [Q8NI51-6]
CCDS58777.1 [Q8NI51-5]
CCDS58778.1 [Q8NI51-4]
CCDS58779.1 [Q8NI51-8]
CCDS58780.1 [Q8NI51-7]
CCDS58781.1 [Q8NI51-3]
CCDS58782.1 [Q8NI51-2]
CCDS68161.1 [Q8NI51-11]
CCDS68162.1 [Q8NI51-10]

NCBI Reference Sequences

More...RefSeqi		NP_001255969.1, NM_001269040.1 [Q8NI51-1]
NP_001255970.1, NM_001269041.1 [Q8NI51-1]
NP_001255971.1, NM_001269042.1
NP_001255972.1, NM_001269043.1 [Q8NI51-7]
NP_001255973.1, NM_001269044.1 [Q8NI51-3]
NP_001255974.1, NM_001269045.1
NP_001255975.1, NM_001269046.1 [Q8NI51-8]
NP_001255976.1, NM_001269047.1 [Q8NI51-2]
NP_001255977.1, NM_001269048.1 [Q8NI51-4]
NP_001255978.1, NM_001269049.1 [Q8NI51-10]
NP_001255979.1, NM_001269050.1 [Q8NI51-5]
NP_001255980.1, NM_001269051.1
NP_001255981.1, NM_001269052.1
NP_001255983.1, NM_001269054.1 [Q8NI51-6]
NP_001255984.1, NM_001269055.1 [Q8NI51-11]
NP_542185.2, NM_080618.3 [Q8NI51-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000243914; ENSP00000243914; ENSG00000124092 [Q8NI51-1]
ENST00000371196; ENSP00000360239; ENSG00000124092 [Q8NI51-1]
ENST00000422109; ENSP00000413713; ENSG00000124092 [Q8NI51-9]
ENST00000422869; ENSP00000399061; ENSG00000124092 [Q8NI51-2]
ENST00000423479; ENSP00000415579; ENSG00000124092 [Q8NI51-7]
ENST00000429804; ENSP00000415329; ENSG00000124092 [Q8NI51-8]
ENST00000432255; ENSP00000409344; ENSG00000124092 [Q8NI51-4]
ENST00000433949; ENSP00000392034; ENSG00000124092 [Q8NI51-10]
ENST00000502686; ENSP00000437999; ENSG00000124092 [Q8NI51-6]
ENST00000539382; ENSP00000439998; ENSG00000124092 [Q8NI51-5]
ENST00000608263; ENSP00000476783; ENSG00000124092 [Q8NI51-1]
ENST00000608440; ENSP00000477488; ENSG00000124092 [Q8NI51-3]
ENST00000608903; ENSP00000476718; ENSG00000124092 [Q8NI51-11]
ENST00000609232; ENSP00000476398; ENSG00000124092 [Q8NI51-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		140690

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:140690

UCSC genome browser

More...UCSCi		uc010giw.2 human [Q8NI51-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF336042 mRNA Translation: AAM28645.1
AY071919 mRNA Translation: AAL61541.1
DQ294738 mRNA Translation: ABB92839.1
DQ778124 mRNA Translation: ABH10106.1
DQ778108 mRNA Translation: ABH10090.1
DQ778109 mRNA Translation: ABH10091.1
DQ778110 mRNA Translation: ABH10092.1
DQ778111 mRNA Translation: ABH10093.1
DQ778112 mRNA Translation: ABH10094.1
DQ778115 mRNA Translation: ABH10097.1
DQ778116 mRNA Translation: ABH10098.1
DQ778121 mRNA Translation: ABH10103.2
DQ778123 mRNA Translation: ABH10105.1
DQ778125 mRNA Translation: ABH10107.2
DQ778126 mRNA Translation: ABH10108.1
DQ778127 mRNA Translation: ABH10109.1
AK128070 mRNA Translation: BAG54626.1
AL035541 Genomic DNA No translation available.
AL160176 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75518.1
BC130486 mRNA Translation: AAI30487.1
CCDSiCCDS13459.1 [Q8NI51-1]
CCDS58776.1 [Q8NI51-6]
CCDS58777.1 [Q8NI51-5]
CCDS58778.1 [Q8NI51-4]
CCDS58779.1 [Q8NI51-8]
CCDS58780.1 [Q8NI51-7]
CCDS58781.1 [Q8NI51-3]
CCDS58782.1 [Q8NI51-2]
CCDS68161.1 [Q8NI51-11]
CCDS68162.1 [Q8NI51-10]
RefSeqiNP_001255969.1, NM_001269040.1 [Q8NI51-1]
NP_001255970.1, NM_001269041.1 [Q8NI51-1]
NP_001255971.1, NM_001269042.1
NP_001255972.1, NM_001269043.1 [Q8NI51-7]
NP_001255973.1, NM_001269044.1 [Q8NI51-3]
NP_001255974.1, NM_001269045.1
NP_001255975.1, NM_001269046.1 [Q8NI51-8]
NP_001255976.1, NM_001269047.1 [Q8NI51-2]
NP_001255977.1, NM_001269048.1 [Q8NI51-4]
NP_001255978.1, NM_001269049.1 [Q8NI51-10]
NP_001255979.1, NM_001269050.1 [Q8NI51-5]
NP_001255980.1, NM_001269051.1
NP_001255981.1, NM_001269052.1
NP_001255983.1, NM_001269054.1 [Q8NI51-6]
NP_001255984.1, NM_001269055.1 [Q8NI51-11]
NP_542185.2, NM_080618.3 [Q8NI51-1]

3D structure databases

SMRiQ8NI51
ModBaseiSearch...

Protein-protein interaction databases

BioGridi126653, 11 interactors
IntActiQ8NI51, 15 interactors
STRINGi9606.ENSP00000415579

PTM databases

iPTMnetiQ8NI51
PhosphoSitePlusiQ8NI51

Polymorphism and mutation databases

BioMutaiCTCFL
DMDMi313104098

Proteomic databases

jPOSTiQ8NI51
MassIVEiQ8NI51
MaxQBiQ8NI51
PaxDbiQ8NI51
PeptideAtlasiQ8NI51
PRIDEiQ8NI51
ProteomicsDBi1764
1765
1766
1767
1768
1769
1770
18412
73832 [Q8NI51-1]

Genome annotation databases

EnsembliENST00000243914; ENSP00000243914; ENSG00000124092 [Q8NI51-1]
ENST00000371196; ENSP00000360239; ENSG00000124092 [Q8NI51-1]
ENST00000422109; ENSP00000413713; ENSG00000124092 [Q8NI51-9]
ENST00000422869; ENSP00000399061; ENSG00000124092 [Q8NI51-2]
ENST00000423479; ENSP00000415579; ENSG00000124092 [Q8NI51-7]
ENST00000429804; ENSP00000415329; ENSG00000124092 [Q8NI51-8]
ENST00000432255; ENSP00000409344; ENSG00000124092 [Q8NI51-4]
ENST00000433949; ENSP00000392034; ENSG00000124092 [Q8NI51-10]
ENST00000502686; ENSP00000437999; ENSG00000124092 [Q8NI51-6]
ENST00000539382; ENSP00000439998; ENSG00000124092 [Q8NI51-5]
ENST00000608263; ENSP00000476783; ENSG00000124092 [Q8NI51-1]
ENST00000608440; ENSP00000477488; ENSG00000124092 [Q8NI51-3]
ENST00000608903; ENSP00000476718; ENSG00000124092 [Q8NI51-11]
ENST00000609232; ENSP00000476398; ENSG00000124092 [Q8NI51-1]
GeneIDi140690
KEGGihsa:140690
UCSCiuc010giw.2 human [Q8NI51-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		140690
DisGeNETi140690
EuPathDBiHostDB:ENSG00000124092.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		CTCFL
HGNCiHGNC:16234 CTCFL
HPAiHPA001472
MIMi607022 gene
neXtProtiNX_Q8NI51
OpenTargetsiENSG00000124092
PharmGKBiPA26999

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000161524
HOGENOMiHOG000276534
InParanoidiQ8NI51
OMAiTICEYSS
OrthoDBi1318335at2759
PhylomeDBiQ8NI51
TreeFamiTF106430

Enzyme and pathway databases

SignaLinkiQ8NI51
SIGNORiQ8NI51

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CTCFL human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CTCFL

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		140690
PharosiQ8NI51 Tbio

Protein Ontology

More...PROi		PR:Q8NI51
RNActiQ8NI51 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000124092 Expressed in 34 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ8NI51 baseline and differential
GenevisibleiQ8NI51 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 11 hits
SUPFAMiSSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 7 hits
PS50157 ZINC_FINGER_C2H2_2, 11 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCTCFL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NI51
Secondary accession number(s): A0S6W1
, A1L4C6, A6XGL8, A6XGM2, A6XGM3, A6XGM8, A6XGN0, A6XGN1, A6XGN2, A6XGN3, A6XGN4, E7EQ27, E7EUE3, E9PBA9, Q5JUG4, Q9BZ30, Q9NQJ3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: November 30, 2010
Last modified: December 11, 2019
This is version 164 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again