Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcriptional repressor CTCFL

Gene

CTCFL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. This probably leads to recruit de novo DNA methyltransferases at these sites (By similarity). Seems to act as tumor suppressor. In association with DNMT1 and DNMT3B, involved in activation of BAG1 gene expression by binding to its promoter. Required for dimethylation of H3 lysine 4 (H3K4me2) of MYC and BRCA1 promoters.By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri257 – 279C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri285 – 307C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri313 – 336C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri342 – 364C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 392C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri398 – 421C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri428 – 451C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri458 – 480C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri486 – 508C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri514 – 537C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri546 – 568C2H2-type 11; atypicalPROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, Chromatin regulator, DNA-binding, Repressor
Biological processCell cycle, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SIGNORiQ8NI51

Names & Taxonomyi

Protein namesi
Recommended name:
Transcriptional repressor CTCFL
Alternative name(s):
Brother of the regulator of imprinted sites
CCCTC-binding factor
CTCF paralog
CTCF-like protein
Cancer/testis antigen 27
Short name:
CT27
Zinc finger protein CTCF-T
Gene namesi
Name:CTCFL
Synonyms:BORIS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000124092.12
HGNCiHGNC:16234 CTCFL
MIMi607022 gene
neXtProtiNX_Q8NI51

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi140690
OpenTargetsiENSG00000124092
PharmGKBiPA26999

Polymorphism and mutation databases

BioMutaiCTCFL
DMDMi313104098

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000472261 – 663Transcriptional repressor CTCFLAdd BLAST663

Proteomic databases

EPDiQ8NI51
MaxQBiQ8NI51
PaxDbiQ8NI51
PeptideAtlasiQ8NI51
PRIDEiQ8NI51
ProteomicsDBi73832

PTM databases

iPTMnetiQ8NI51
PhosphoSitePlusiQ8NI51

Expressioni

Tissue specificityi

Testis specific. Specifically expressed in primary spermatocytes.

Developmental stagei

Is up-regulated in primary spermatocytes (expression overlapping with the genome-wide erasure of methylation) to become silenced on activation of CTCF in post-meiotic germline cells (expression corresponding to DNA remethylation).

Gene expression databases

BgeeiENSG00000124092 Expressed in 34 organ(s), highest expression level in secondary oocyte
CleanExiHS_CTCFL
ExpressionAtlasiQ8NI51 baseline and differential
GenevisibleiQ8NI51 HS

Organism-specific databases

HPAiHPA001472

Interactioni

Subunit structurei

Interacts with histones, PRMT7 and SETD1A. Interacts (via N-terminus) with BAG6/BAT3.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi126653, 11 interactors
IntActiQ8NI51, 15 interactors
STRINGi9606.ENSP00000243914

Structurei

3D structure databases

ProteinModelPortaliQ8NI51
SMRiQ8NI51
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CTCF zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri257 – 279C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri285 – 307C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri313 – 336C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri342 – 364C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 392C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri398 – 421C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri428 – 451C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri458 – 480C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri486 – 508C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri514 – 537C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri546 – 568C2H2-type 11; atypicalPROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00890000139371
HOGENOMiHOG000276534
HOVERGENiHBG101121
InParanoidiQ8NI51
OMAiTICEYSS
OrthoDBiEOG091G06B4
PhylomeDBiQ8NI51
TreeFamiTF106430

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 11 hits
SUPFAMiSSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 7 hits
PS50157 ZINC_FINGER_C2H2_2, 11 hits

Sequences (11+)i

Sequence statusi: Complete.

This entry describes 11 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 11 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NI51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAATEISVLS EQFTKIKELE LMPEKGLKEE EKDGVCREKD HRSPSELEAE
60 70 80 90 100
RTSGAFQDSV LEEEVELVLA PSEESEKYIL TLQTVHFTSE AVELQDMSLL
110 120 130 140 150
SIQQQEGVQV VVQQPGPGLL WLEEGPRQSL QQCVAISIQQ ELYSPQEMEV
160 170 180 190 200
LQFHALEENV MVASEDSKLA VSLAETTGLI KLEEEQEKNQ LLAERTKEQL
210 220 230 240 250
FFVETMSGDE RSDEIVLTVS NSNVEEQEDQ PTAGQADAEK AKSTKNQRKT
260 270 280 290 300
KGAKGTFHCD VCMFTSSRMS SFNRHMKTHT SEKPHLCHLC LKTFRTVTLL
310 320 330 340 350
RNHVNTHTGT RPYKCNDCNM AFVTSGELVR HRRYKHTHEK PFKCSMCKYA
360 370 380 390 400
SVEASKLKRH VRSHTGERPF QCCQCSYASR DTYKLKRHMR THSGEKPYEC
410 420 430 440 450
HICHTRFTQS GTMKIHILQK HGENVPKYQC PHCATIIARK SDLRVHMRNL
460 470 480 490 500
HAYSAAELKC RYCSAVFHER YALIQHQKTH KNEKRFKCKH CSYACKQERH
510 520 530 540 550
MTAHIRTHTG EKPFTCLSCN KCFRQKQLLN AHFRKYHDAN FIPTVYKCSK
560 570 580 590 600
CGKGFSRWIN LHRHSEKCGS GEAKSAASGK GRRTRKRKQT ILKEATKGQK
610 620 630 640 650
EAAKGWKEAA NGDEAAAEEA STTKGEQFPG EMFPVACRET TARVKEEVDE
660
GVTCEMLLNT MDK
Length:663
Mass (Da):75,747
Last modified:November 30, 2010 - v2
Checksum:i9351E1A85173D085
GO
Isoform 2 (identifier: Q8NI51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     560-663: NLHRHSEKCG...CEMLLNTMDK → TSKWSGLKPQTFIT

Show »
Length:573
Mass (Da):66,029
Checksum:i79DFEA839B95D94B
GO
Isoform 3 (identifier: Q8NI51-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:665
Mass (Da):75,836
Checksum:i322DE1AF4BD6328E
GO
Isoform 4 (identifier: Q8NI51-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-497: Missing.
     560-663: NLHRHSEKCG...CEMLLNTMDK → LWVGNSEVAE...LLQGPLCRAA

Show »
Length:483
Mass (Da):54,194
Checksum:iAA920F461EC5A901
GO
Isoform 5 (identifier: Q8NI51-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
     560-663: NLHRHSEKCG...CEMLLNTMDK → LWVGNSEVAE...LLQGPLCRAA

Show »
Length:422
Mass (Da):48,088
Checksum:i363AC9455A24D686
GO
Isoform 6 (identifier: Q8NI51-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:403
Mass (Da):46,538
Checksum:i141E4AFDF4B5BC2E
GO
Isoform 7 (identifier: Q8NI51-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     663-663: K → NSAGCTGRMMLVSAWLLGRPQETYNQGRRRRGSRRVTW

Show »
Length:700
Mass (Da):80,010
Checksum:iC5ECEB4A1EFA816F
GO
Isoform 8 (identifier: Q8NI51-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     395-444: Missing.

Show »
Length:613
Mass (Da):69,916
Checksum:i4192478A258CB6A1
GO
Isoform 9 (identifier: Q8NI51-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-427: GEKPYECHICHTRFTQSGTMKIHILQKHGENVPK → EATSKRSLQEIPRCKFHPDCLQMLQVWQRLFPLD
     428-663: Missing.

Show »
Length:427
Mass (Da):48,929
Checksum:iAF3D08C4C3250FAA
GO
Isoform 10 (identifier: Q8NI51-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:460
Mass (Da):52,690
Checksum:i55F8D2CC9872A225
GO
Isoform 11 (identifier: Q8NI51-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     559-663: INLHRHSEKC...CEMLLNTMDK → VLY

Show »
Length:299
Mass (Da):35,417
Checksum:i15FF2AEC96221604
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GYX4V9GYX4_HUMAN
Transcriptional repressor CTCFL
CTCFL
404Annotation score:
V9GY73V9GY73_HUMAN
Transcriptional repressor CTCFL
CTCFL
627Annotation score:
F5H2V8F5H2V8_HUMAN
Transcriptional repressor CTCFL
CTCFL
451Annotation score:
V9GZ46V9GZ46_HUMAN
Transcriptional repressor CTCFL
CTCFL
426Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti613Missing in AAL61541 (PubMed:17048991).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02321350E → Q. Corresponds to variant dbSNP:rs6070128Ensembl.1
Natural variantiVAR_023214177T → A4 PublicationsCorresponds to variant dbSNP:rs6025606Ensembl.1
Natural variantiVAR_057374448R → H. Corresponds to variant dbSNP:rs6092491Ensembl.1
Natural variantiVAR_032766525Q → E. Corresponds to variant dbSNP:rs6070122Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451551 – 262Missing in isoform 6 and isoform 11. 1 PublicationAdd BLAST262
Alternative sequenceiVSP_0451561 – 205Missing in isoform 5 and isoform 10. 1 PublicationAdd BLAST205
Alternative sequenceiVSP_045157354 – 497Missing in isoform 4. 1 PublicationAdd BLAST144
Alternative sequenceiVSP_047725394 – 427GEKPY…ENVPK → EATSKRSLQEIPRCKFHPDC LQMLQVWQRLFPLD in isoform 9. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_047058395 – 444Missing in isoform 8. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_047726428 – 663Missing in isoform 9. 1 PublicationAdd BLAST236
Alternative sequenceiVSP_054899559 – 663INLHR…NTMDK → VLY in isoform 11. 1 PublicationAdd BLAST105
Alternative sequenceiVSP_045158560 – 663NLHRH…NTMDK → TSKWSGLKPQTFIT in isoform 2. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_045159560 – 663NLHRH…NTMDK → LWVGNSEVAELGGPGSGPLL RLQSGCPPGLHHPKAGLGPE DPLPGQLRHTTAGTGLSSLL QGPLCRAA in isoform 4 and isoform 5. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_045160614 – 663EAAAE…NTMDK → GVISAHRNLCLLGSSDSHAS VSGAGITDARHHAWLIVLLF LVEMGFYHVSHS in isoform 3, isoform 6 and isoform 10. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_047059663K → NSAGCTGRMMLVSAWLLGRP QETYNQGRRRRGSRRVTW in isoform 7. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF336042 mRNA Translation: AAM28645.1
AY071919 mRNA Translation: AAL61541.1
DQ294738 mRNA Translation: ABB92839.1
DQ778124 mRNA Translation: ABH10106.1
DQ778108 mRNA Translation: ABH10090.1
DQ778109 mRNA Translation: ABH10091.1
DQ778110 mRNA Translation: ABH10092.1
DQ778111 mRNA Translation: ABH10093.1
DQ778112 mRNA Translation: ABH10094.1
DQ778115 mRNA Translation: ABH10097.1
DQ778116 mRNA Translation: ABH10098.1
DQ778121 mRNA Translation: ABH10103.2
DQ778123 mRNA Translation: ABH10105.1
DQ778125 mRNA Translation: ABH10107.2
DQ778126 mRNA Translation: ABH10108.1
DQ778127 mRNA Translation: ABH10109.1
AK128070 mRNA Translation: BAG54626.1
AL035541 Genomic DNA No translation available.
AL160176 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75518.1
BC130486 mRNA Translation: AAI30487.1
CCDSiCCDS13459.1 [Q8NI51-1]
CCDS58776.1 [Q8NI51-6]
CCDS58777.1 [Q8NI51-5]
CCDS58778.1 [Q8NI51-4]
CCDS58779.1 [Q8NI51-8]
CCDS58780.1 [Q8NI51-7]
CCDS58781.1 [Q8NI51-3]
CCDS58782.1 [Q8NI51-2]
CCDS68161.1 [Q8NI51-11]
CCDS68162.1 [Q8NI51-10]
RefSeqiNP_001255969.1, NM_001269040.1 [Q8NI51-1]
NP_001255970.1, NM_001269041.1 [Q8NI51-1]
NP_001255971.1, NM_001269042.1
NP_001255972.1, NM_001269043.1 [Q8NI51-7]
NP_001255973.1, NM_001269044.1 [Q8NI51-3]
NP_001255974.1, NM_001269045.1
NP_001255975.1, NM_001269046.1 [Q8NI51-8]
NP_001255976.1, NM_001269047.1 [Q8NI51-2]
NP_001255977.1, NM_001269048.1 [Q8NI51-4]
NP_001255978.1, NM_001269049.1 [Q8NI51-10]
NP_001255979.1, NM_001269050.1 [Q8NI51-5]
NP_001255980.1, NM_001269051.1
NP_001255981.1, NM_001269052.1
NP_001255983.1, NM_001269054.1 [Q8NI51-6]
NP_001255984.1, NM_001269055.1 [Q8NI51-11]
NP_542185.2, NM_080618.3 [Q8NI51-1]
UniGeneiHs.131543

Genome annotation databases

EnsembliENST00000243914; ENSP00000243914; ENSG00000124092 [Q8NI51-1]
ENST00000371196; ENSP00000360239; ENSG00000124092 [Q8NI51-1]
ENST00000422109; ENSP00000413713; ENSG00000124092 [Q8NI51-9]
ENST00000422869; ENSP00000399061; ENSG00000124092 [Q8NI51-2]
ENST00000423479; ENSP00000415579; ENSG00000124092 [Q8NI51-7]
ENST00000429804; ENSP00000415329; ENSG00000124092 [Q8NI51-8]
ENST00000432255; ENSP00000409344; ENSG00000124092 [Q8NI51-4]
ENST00000433949; ENSP00000392034; ENSG00000124092 [Q8NI51-10]
ENST00000502686; ENSP00000437999; ENSG00000124092 [Q8NI51-6]
ENST00000539382; ENSP00000439998; ENSG00000124092 [Q8NI51-5]
ENST00000608263; ENSP00000476783; ENSG00000124092 [Q8NI51-1]
ENST00000608440; ENSP00000477488; ENSG00000124092 [Q8NI51-3]
ENST00000608903; ENSP00000476718; ENSG00000124092 [Q8NI51-11]
ENST00000609232; ENSP00000476398; ENSG00000124092 [Q8NI51-1]
GeneIDi140690
KEGGihsa:140690
UCSCiuc010giw.2 human [Q8NI51-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF336042 mRNA Translation: AAM28645.1
AY071919 mRNA Translation: AAL61541.1
DQ294738 mRNA Translation: ABB92839.1
DQ778124 mRNA Translation: ABH10106.1
DQ778108 mRNA Translation: ABH10090.1
DQ778109 mRNA Translation: ABH10091.1
DQ778110 mRNA Translation: ABH10092.1
DQ778111 mRNA Translation: ABH10093.1
DQ778112 mRNA Translation: ABH10094.1
DQ778115 mRNA Translation: ABH10097.1
DQ778116 mRNA Translation: ABH10098.1
DQ778121 mRNA Translation: ABH10103.2
DQ778123 mRNA Translation: ABH10105.1
DQ778125 mRNA Translation: ABH10107.2
DQ778126 mRNA Translation: ABH10108.1
DQ778127 mRNA Translation: ABH10109.1
AK128070 mRNA Translation: BAG54626.1
AL035541 Genomic DNA No translation available.
AL160176 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75518.1
BC130486 mRNA Translation: AAI30487.1
CCDSiCCDS13459.1 [Q8NI51-1]
CCDS58776.1 [Q8NI51-6]
CCDS58777.1 [Q8NI51-5]
CCDS58778.1 [Q8NI51-4]
CCDS58779.1 [Q8NI51-8]
CCDS58780.1 [Q8NI51-7]
CCDS58781.1 [Q8NI51-3]
CCDS58782.1 [Q8NI51-2]
CCDS68161.1 [Q8NI51-11]
CCDS68162.1 [Q8NI51-10]
RefSeqiNP_001255969.1, NM_001269040.1 [Q8NI51-1]
NP_001255970.1, NM_001269041.1 [Q8NI51-1]
NP_001255971.1, NM_001269042.1
NP_001255972.1, NM_001269043.1 [Q8NI51-7]
NP_001255973.1, NM_001269044.1 [Q8NI51-3]
NP_001255974.1, NM_001269045.1
NP_001255975.1, NM_001269046.1 [Q8NI51-8]
NP_001255976.1, NM_001269047.1 [Q8NI51-2]
NP_001255977.1, NM_001269048.1 [Q8NI51-4]
NP_001255978.1, NM_001269049.1 [Q8NI51-10]
NP_001255979.1, NM_001269050.1 [Q8NI51-5]
NP_001255980.1, NM_001269051.1
NP_001255981.1, NM_001269052.1
NP_001255983.1, NM_001269054.1 [Q8NI51-6]
NP_001255984.1, NM_001269055.1 [Q8NI51-11]
NP_542185.2, NM_080618.3 [Q8NI51-1]
UniGeneiHs.131543

3D structure databases

ProteinModelPortaliQ8NI51
SMRiQ8NI51
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126653, 11 interactors
IntActiQ8NI51, 15 interactors
STRINGi9606.ENSP00000243914

PTM databases

iPTMnetiQ8NI51
PhosphoSitePlusiQ8NI51

Polymorphism and mutation databases

BioMutaiCTCFL
DMDMi313104098

Proteomic databases

EPDiQ8NI51
MaxQBiQ8NI51
PaxDbiQ8NI51
PeptideAtlasiQ8NI51
PRIDEiQ8NI51
ProteomicsDBi73832

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000243914; ENSP00000243914; ENSG00000124092 [Q8NI51-1]
ENST00000371196; ENSP00000360239; ENSG00000124092 [Q8NI51-1]
ENST00000422109; ENSP00000413713; ENSG00000124092 [Q8NI51-9]
ENST00000422869; ENSP00000399061; ENSG00000124092 [Q8NI51-2]
ENST00000423479; ENSP00000415579; ENSG00000124092 [Q8NI51-7]
ENST00000429804; ENSP00000415329; ENSG00000124092 [Q8NI51-8]
ENST00000432255; ENSP00000409344; ENSG00000124092 [Q8NI51-4]
ENST00000433949; ENSP00000392034; ENSG00000124092 [Q8NI51-10]
ENST00000502686; ENSP00000437999; ENSG00000124092 [Q8NI51-6]
ENST00000539382; ENSP00000439998; ENSG00000124092 [Q8NI51-5]
ENST00000608263; ENSP00000476783; ENSG00000124092 [Q8NI51-1]
ENST00000608440; ENSP00000477488; ENSG00000124092 [Q8NI51-3]
ENST00000608903; ENSP00000476718; ENSG00000124092 [Q8NI51-11]
ENST00000609232; ENSP00000476398; ENSG00000124092 [Q8NI51-1]
GeneIDi140690
KEGGihsa:140690
UCSCiuc010giw.2 human [Q8NI51-1]

Organism-specific databases

CTDi140690
DisGeNETi140690
EuPathDBiHostDB:ENSG00000124092.12
GeneCardsiCTCFL
H-InvDBiHIX0027672
HGNCiHGNC:16234 CTCFL
HPAiHPA001472
MIMi607022 gene
neXtProtiNX_Q8NI51
OpenTargetsiENSG00000124092
PharmGKBiPA26999
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00890000139371
HOGENOMiHOG000276534
HOVERGENiHBG101121
InParanoidiQ8NI51
OMAiTICEYSS
OrthoDBiEOG091G06B4
PhylomeDBiQ8NI51
TreeFamiTF106430

Enzyme and pathway databases

SIGNORiQ8NI51

Miscellaneous databases

GeneWikiiCTCFL
GenomeRNAii140690
PROiPR:Q8NI51
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124092 Expressed in 34 organ(s), highest expression level in secondary oocyte
CleanExiHS_CTCFL
ExpressionAtlasiQ8NI51 baseline and differential
GenevisibleiQ8NI51 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 11 hits
SUPFAMiSSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 7 hits
PS50157 ZINC_FINGER_C2H2_2, 11 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCTCFL_HUMAN
AccessioniPrimary (citable) accession number: Q8NI51
Secondary accession number(s): A0S6W1
, A1L4C6, A6XGL8, A6XGM2, A6XGM3, A6XGM8, A6XGN0, A6XGN1, A6XGN2, A6XGN3, A6XGN4, E7EQ27, E7EUE3, E9PBA9, Q5JUG4, Q9BZ30, Q9NQJ3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: November 30, 2010
Last modified: November 7, 2018
This is version 153 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again