Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

InaD-like protein

Gene

PATJ

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane. May regulate protein targeting, cell polarity and integrity of tight junctions. May regulate the surface expression and/or function of ASIC3 in sensory neurons. May recruit ARHGEF18 to apical cell-cell boundaries (PubMed:22006950).2 Publications

GO - Biological processi

  • bicellular tight junction assembly Source: Reactome
  • intracellular signal transduction Source: UniProtKB

Enzyme and pathway databases

ReactomeiR-HSA-420029 Tight junction interactions
SignaLinkiQ8NI35
SIGNORiQ8NI35

Names & Taxonomyi

Protein namesi
Recommended name:
InaD-like protein
Short name:
Inadl protein
Short name:
hINADL
Alternative name(s):
Pals1-associated tight junction protein
Protein associated to tight junctions
Gene namesi
Name:PATJ1 PublicationImported
Synonyms:INADL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000132849.19
HGNCiHGNC:28881 PATJ
MIMi603199 gene
neXtProtiNX_Q8NI35

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Tight junction

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi19L → W: Reduces L27 domain binding affinity to MPP5 L27 domain. 1 Publication1
Mutagenesisi38F → W: Reduces L27 domain binding affinity to MPP5 L27 domain. 1 Publication1

Organism-specific databases

DisGeNETi10207
OpenTargetsiENSG00000132849
PharmGKBiPA134919267

Polymorphism and mutation databases

BioMutaiINADL
DMDMi116242542

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945921 – 1801InaD-like proteinAdd BLAST1801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei455PhosphoserineCombined sources1
Modified residuei459PhosphoserineCombined sources1
Modified residuei522PhosphoserineCombined sources1
Modified residuei645PhosphoserineCombined sources1
Modified residuei1209PhosphothreonineCombined sources1
Modified residuei1212PhosphoserineCombined sources1
Modified residuei1508PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8NI35
MaxQBiQ8NI35
PaxDbiQ8NI35
PeptideAtlasiQ8NI35
PRIDEiQ8NI35
ProteomicsDBi73822
73823 [Q8NI35-2]
73824 [Q8NI35-3]
73825 [Q8NI35-4]
73826 [Q8NI35-5]

PTM databases

iPTMnetiQ8NI35
PhosphoSitePlusiQ8NI35

Expressioni

Tissue specificityi

Expressed in bladder, testis, ovary, small intestine, colon, heart, skeletal muscle, pancreas and cerebellum in the brain.2 Publications

Gene expression databases

BgeeiENSG00000132849 Expressed in 214 organ(s), highest expression level in cerebellar vermis
ExpressionAtlasiQ8NI35 baseline and differential
GenevisibleiQ8NI35 HS

Organism-specific databases

HPAiHPA066352
HPA066960
HPA069079

Interactioni

Subunit structurei

Interacts with ASIC3, KCNJ10, KCNJ15, GRIN2A, GRIN2B, GRIN2C, GRIN2D, NLGN2, MPP7, HTR2A and SLC6A4 (By similarity). Forms a ternary complex with MPP5, CRB1 and CRB3. Interacts with TJP3/ZO-3 and CLDN1/claudin-1. Component of a complex whose core is composed of ARHGAP17, AMOT, MPP5/PALS1, INADL/PATJ and PARD3/PAR3. Directly interacts with HTR4 (By similarity). Interacts (via PDZ domain 8) with WWC1 (via the ADDV motif). Interacts (via C-terminus) with ARHGEF18 (PubMed:22006950).By similarity6 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi115502, 40 interactors
CORUMiQ8NI35
IntActiQ8NI35, 35 interactors
MINTiQ8NI35
STRINGi9606.ENSP00000360200

Structurei

Secondary structure

11801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8NI35
SMRiQ8NI35
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8NI35

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 65L27PROSITE-ProRule annotationAdd BLAST65
Domaini134 – 221PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini248 – 328PDZ 2PROSITE-ProRule annotationAdd BLAST81
Domaini365 – 453PDZ 3PROSITE-ProRule annotationAdd BLAST89
Domaini553 – 639PDZ 4PROSITE-ProRule annotationAdd BLAST87
Domaini686 – 772PDZ 5PROSITE-ProRule annotationAdd BLAST87
Domaini1068 – 1160PDZ 6PROSITE-ProRule annotationAdd BLAST93
Domaini1239 – 1322PDZ 7PROSITE-ProRule annotationAdd BLAST84
Domaini1437 – 1520PDZ 8PROSITE-ProRule annotationAdd BLAST84
Domaini1533 – 1615PDZ 9PROSITE-ProRule annotationAdd BLAST83
Domaini1676 – 1762PDZ 10PROSITE-ProRule annotationAdd BLAST87

Domaini

The L27 domain (also called Maguk recruitment domain) is required for interaction with MPP5 and CRB3, and MPP5 localization to tight junctions.
The PDZ domain 6 mediates interaction with the C-terminus of TJP3 and is crucial for localization to the tight junctions. The PDZ domain 8 interacts with CLDN1 but is not required for proper localization.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
KOG3528 Eukaryota
ENOG4110362 LUCA
GeneTreeiENSGT00760000119017
HOVERGENiHBG080134
InParanoidiQ8NI35
OMAiMKENFGI
OrthoDBiEOG091G0P7K
PhylomeDBiQ8NI35
TreeFamiTF330709

Family and domain databases

InterProiView protein in InterPro
IPR015132 L27_2
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF09045 L27_2, 1 hit
PF00595 PDZ, 9 hits
SMARTiView protein in SMART
SM00569 L27, 1 hit
SM00228 PDZ, 10 hits
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50156 SSF50156, 10 hits
PROSITEiView protein in PROSITE
PS51022 L27, 1 hit
PS50106 PDZ, 10 hits

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NI35-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPENPATDKL QVLQVLDRLK MKLQEKGDTS QNEKLSMFYE TLKSPLFNQI
60 70 80 90 100
LTLQQSIKQL KGQLNHIPSD CSANFDFSRK GLLVFTDGSI TNGNVHRPSN
110 120 130 140 150
NSTVSGLFPW TPKLGNEDFN SVIQQMAQGR QIEYIDIERP STGGLGFSVV
160 170 180 190 200
ALRSQNLGKV DIFVKDVQPG SVADRDQRLK ENDQILAINH TPLDQNISHQ
210 220 230 240 250
QAIALLQQTT GSLRLIVARE PVHTKSSTSS SLNDTTLPET VCWGHVEEVE
260 270 280 290 300
LINDGSGLGF GIVGGKTSGV VVRTIVPGGL ADRDGRLQTG DHILKIGGTN
310 320 330 340 350
VQGMTSEQVA QVLRNCGNSV RMLVARDPAG DISVTPPAPA ALPVALPTVA
360 370 380 390 400
SKGPGSDSSL FETYNVELVR KDGQSLGIRI VGYVGTSHTG EASGIYVKSI
410 420 430 440 450
IPGSAAYHNG HIQVNDKIVA VDGVNIQGFA NHDVVEVLRN AGQVVHLTLV
460 470 480 490 500
RRKTSSSTSP LEPPSDRGTV VEPLKPPALF LTGAVETETN VDGEDEEIKE
510 520 530 540 550
RIDTLKNDNI QALEKLEKVP DSPENELKSR WENLLGPDYE VMVATLDTQI
560 570 580 590 600
ADDAELQKYS KLLPIHTLRL GVEVDSFDGH HYISSIVSGG PVDTLGLLQP
610 620 630 640 650
EDELLEVNGM QLYGKSRREA VSFLKEVPPP FTLVCCRRLF DDEASVDEPR
660 670 680 690 700
RTETSLPETE VDHNMDVNTE EDDDGELALW SPEVKIVELV KDCKGLGFSI
710 720 730 740 750
LDYQDPLDPT RSVIVIRSLV ADGVAERSGG LLPGDRLVSV NEYCLDNTSL
760 770 780 790 800
AEAVEILKAV PPGLVHLGIC KPLVEDNEEE SCYILHSSSN EDKTEFSGTI
810 820 830 840 850
HDINSSLILE APKGFRDEPY FKEELVDEPF LDLGKSFHSQ QKEIEQSKEA
860 870 880 890 900
WEMHEFLTPR LQEMDEEREI LVDEEYELYQ DPSPSMELYP LSHIQEATPV
910 920 930 940 950
PSVNELHFGT QWLHDNEPSE SQEARTGRTV YSQEAQPYGY CPENVMKENF
960 970 980 990 1000
VMESLPSVPS TEGNSQQGRF DDLENLNSLA KTSLDLGMIP NDVQGPSLLI
1010 1020 1030 1040 1050
DLPVVAQRRE QEDLPLYQHQ ATRVISKASA YTGMLSSRYA TDTCELPERE
1060 1070 1080 1090 1100
EGEGEETPNF SHWGPPRIVE IFREPNVSLG ISIVGGQTVI KRLKNGEELK
1110 1120 1130 1140 1150
GIFIKQVLED SPAGKTNALK TGDKILEVSG VDLQNASHSE AVEAIKNAGN
1160 1170 1180 1190 1200
PVVFIVQSLS STPRVIPNVH NKANKITGNQ NQDTQEKKEK RQGTAPPPMK
1210 1220 1230 1240 1250
LPPPYKALTD DSDENEEEDA FTDQKIRQRY ADLPGELHII ELEKDKNGLG
1260 1270 1280 1290 1300
LSLAGNKDRS RMSIFVVGIN PEGPAAADGR MRIGDELLEI NNQILYGRSH
1310 1320 1330 1340 1350
QNASAIIKTA PSKVKLVFIR NEDAVNQMAV TPFPVPSSSP SSIEDQSGTE
1360 1370 1380 1390 1400
PISSEEDGSV EVGIKQLPES ESFKLAVSQM KQQKYPTKVS FSSQEIPLAP
1410 1420 1430 1440 1450
ASSYHSTDAD FTGYGGFQAP LSVDPATCPI VPGQEMIIEI SKGRSGLGLS
1460 1470 1480 1490 1500
IVGGKDTPLN AIVIHEVYEE GAAARDGRLW AGDQILEVNG VDLRNSSHEE
1510 1520 1530 1540 1550
AITALRQTPQ KVRLVVYRDE AHYRDEENLE IFPVDLQKKA GRGLGLSIVG
1560 1570 1580 1590 1600
KRNGSGVFIS DIVKGGAADL DGRLIQGDQI LSVNGEDMRN ASQETVATIL
1610 1620 1630 1640 1650
KCAQGLVQLE IGRLRAGSWT SARTTSQNSQ GSQQSAHSSC HPSFAPVITG
1660 1670 1680 1690 1700
LQNLVGTKRV SDPSQKNSGT DMEPRTVEIN RELSDALGIS IAGGRGSPLG
1710 1720 1730 1740 1750
DIPVFIAMIQ ASGVAARTQK LKVGDRIVSI NGQPLDGLSH ADVVNLLKNA
1760 1770 1780 1790 1800
YGRIILQVVA DTNISAIAAQ LENMSTGYHL GSPTAEHHPE DTEEQLQMTA

D
Length:1,801
Mass (Da):196,368
Last modified:October 17, 2006 - v3
Checksum:i313DD1F12B6AD80A
GO
Isoform 2 (identifier: Q8NI35-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1459-1459: L → LFWRLGSPRAWSQHLVRAFMLHHPVTEVEGQ
     1553-1801: Missing.

Show »
Length:1,582
Mass (Da):173,793
Checksum:i9444B48DB84DE81E
GO
Isoform 3 (identifier: Q8NI35-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1553-1801: Missing.

Show »
Length:1,552
Mass (Da):170,238
Checksum:i646145A57C61152A
GO
Isoform 4 (identifier: Q8NI35-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1460-1487: Missing.
     1553-1801: Missing.

Show »
Length:1,524
Mass (Da):167,159
Checksum:i5203884719B4B152
GO
Isoform 5 (identifier: Q8NI35-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-541: Missing.
     1631-1675: GSQQSAHSSC...KNSGTDMEPR → SAECTQQLSS...FRHRYGTKDC
     1676-1801: Missing.

Show »
Length:1,134
Mass (Da):125,231
Checksum:i2717B2D492419866
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WUZ6A0A087WUZ6_HUMAN
InaD-like protein
PATJ
1,182Annotation score:
A0A0X1KG69A0A0X1KG69_HUMAN
InaD-like protein
PATJ
1,181Annotation score:
A0A0U1RR46A0A0U1RR46_HUMAN
InaD-like protein
PATJ
683Annotation score:
A0A2R8Y549A0A2R8Y549_HUMAN
InaD-like protein
PATJ
1,882Annotation score:
B4DE90B4DE90_HUMAN
cDNA FLJ59473, highly similar to In...
PATJ
452Annotation score:
A0A0U1RQT2A0A0U1RQT2_HUMAN
InaD-like protein
PATJ
593Annotation score:
A0A0U1RQR3A0A0U1RQR3_HUMAN
InaD-like protein
PATJ
139Annotation score:
A0A0U1RRD7A0A0U1RRD7_HUMAN
InaD-like protein
PATJ
111Annotation score:
A0A0U1RQW4A0A0U1RQW4_HUMAN
InaD-like protein
PATJ
146Annotation score:
A0A2R8Y5I3A0A2R8Y5I3_HUMAN
InaD-like protein
PATJ
666Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1443G → R in CAA04666 (PubMed:9280290).Curated1
Sequence conflicti1699L → I in AAM28433 (PubMed:11927608).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_027988303G → R. Corresponds to variant dbSNP:rs3762321Ensembl.1
Natural variantiVAR_027989362E → A. Corresponds to variant dbSNP:rs1286823Ensembl.1
Natural variantiVAR_027990400I → V. Corresponds to variant dbSNP:rs7516332Ensembl.1
Natural variantiVAR_027991599Q → H. Corresponds to variant dbSNP:rs1286812Ensembl.1
Natural variantiVAR_022695744C → R1 PublicationCorresponds to variant dbSNP:rs1134764Ensembl.1
Natural variantiVAR_027992779E → K. Corresponds to variant dbSNP:rs12141598Ensembl.1
Natural variantiVAR_027993780E → K. Corresponds to variant dbSNP:rs12141599Ensembl.1
Natural variantiVAR_027994870I → M3 PublicationsCorresponds to variant dbSNP:rs2799627Ensembl.1
Natural variantiVAR_0279951178G → S1 PublicationCorresponds to variant dbSNP:rs1056513Ensembl.1
Natural variantiVAR_0279961282R → H2 PublicationsCorresponds to variant dbSNP:rs1134767Ensembl.1
Natural variantiVAR_0279971360V → L2 PublicationsCorresponds to variant dbSNP:rs2498982Ensembl.1
Natural variantiVAR_0279981504A → P. Corresponds to variant dbSNP:rs13376115Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0142041 – 541Missing in isoform 5. 1 PublicationAdd BLAST541
Alternative sequenceiVSP_0142051459L → LFWRLGSPRAWSQHLVRAFM LHHPVTEVEGQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_0142061460 – 1487Missing in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0142071553 – 1801Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_0142081631 – 1675GSQQS…DMEPR → SAECTQQLSSLLRSCHHWPA KPGWHKKSFRSFPEKFRHRY GTKDC in isoform 5. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0142091676 – 1801Missing in isoform 5. 1 PublicationAdd BLAST126

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001306 mRNA Translation: CAA04666.1
AJ224747 mRNA Translation: CAA12112.1
AJ224748 mRNA Translation: CAA12113.1
AB044807 mRNA Translation: BAB19683.1
AF397170 mRNA Translation: AAM28433.1
AC097064 Genomic DNA No translation available.
AL136458 Genomic DNA No translation available.
AL353802 Genomic DNA No translation available.
AL449143 Genomic DNA No translation available.
AL590374 Genomic DNA No translation available.
BC021135 mRNA Translation: AAH21135.1
CCDSiCCDS617.2 [Q8NI35-1]
UniGeneiHs.478125

Genome annotation databases

EnsembliENST00000371158; ENSP00000360200; ENSG00000132849 [Q8NI35-1]
ENST00000484937; ENSP00000433669; ENSG00000132849 [Q8NI35-5]
UCSCiuc001dab.4 human [Q8NI35-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001306 mRNA Translation: CAA04666.1
AJ224747 mRNA Translation: CAA12112.1
AJ224748 mRNA Translation: CAA12113.1
AB044807 mRNA Translation: BAB19683.1
AF397170 mRNA Translation: AAM28433.1
AC097064 Genomic DNA No translation available.
AL136458 Genomic DNA No translation available.
AL353802 Genomic DNA No translation available.
AL449143 Genomic DNA No translation available.
AL590374 Genomic DNA No translation available.
BC021135 mRNA Translation: AAH21135.1
CCDSiCCDS617.2 [Q8NI35-1]
UniGeneiHs.478125

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1VF6X-ray2.10A/B9-67[»]
2D92NMR-A676-770[»]
2DAZNMR-A1219-1329[»]
2DB5NMR-A114-228[»]
2DLUNMR-A238-335[»]
2DM8NMR-A1425-1527[»]
2DMZNMR-A355-470[»]
2EHRNMR-A1058-1167[»]
4Q2NX-ray2.00A/B/C/D/E/F362-452[»]
ProteinModelPortaliQ8NI35
SMRiQ8NI35
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115502, 40 interactors
CORUMiQ8NI35
IntActiQ8NI35, 35 interactors
MINTiQ8NI35
STRINGi9606.ENSP00000360200

PTM databases

iPTMnetiQ8NI35
PhosphoSitePlusiQ8NI35

Polymorphism and mutation databases

BioMutaiINADL
DMDMi116242542

Proteomic databases

EPDiQ8NI35
MaxQBiQ8NI35
PaxDbiQ8NI35
PeptideAtlasiQ8NI35
PRIDEiQ8NI35
ProteomicsDBi73822
73823 [Q8NI35-2]
73824 [Q8NI35-3]
73825 [Q8NI35-4]
73826 [Q8NI35-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371158; ENSP00000360200; ENSG00000132849 [Q8NI35-1]
ENST00000484937; ENSP00000433669; ENSG00000132849 [Q8NI35-5]
UCSCiuc001dab.4 human [Q8NI35-1]

Organism-specific databases

DisGeNETi10207
EuPathDBiHostDB:ENSG00000132849.19
GeneCardsiPATJ
HGNCiHGNC:28881 PATJ
HPAiHPA066352
HPA066960
HPA069079
MIMi603199 gene
neXtProtiNX_Q8NI35
OpenTargetsiENSG00000132849
PharmGKBiPA134919267
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
KOG3528 Eukaryota
ENOG4110362 LUCA
GeneTreeiENSGT00760000119017
HOVERGENiHBG080134
InParanoidiQ8NI35
OMAiMKENFGI
OrthoDBiEOG091G0P7K
PhylomeDBiQ8NI35
TreeFamiTF330709

Enzyme and pathway databases

ReactomeiR-HSA-420029 Tight junction interactions
SignaLinkiQ8NI35
SIGNORiQ8NI35

Miscellaneous databases

ChiTaRSiPATJ human
EvolutionaryTraceiQ8NI35
GeneWikiiINADL
GenomeRNAii10207
PROiPR:Q8NI35
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132849 Expressed in 214 organ(s), highest expression level in cerebellar vermis
ExpressionAtlasiQ8NI35 baseline and differential
GenevisibleiQ8NI35 HS

Family and domain databases

InterProiView protein in InterPro
IPR015132 L27_2
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF09045 L27_2, 1 hit
PF00595 PDZ, 9 hits
SMARTiView protein in SMART
SM00569 L27, 1 hit
SM00228 PDZ, 10 hits
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50156 SSF50156, 10 hits
PROSITEiView protein in PROSITE
PS51022 L27, 1 hit
PS50106 PDZ, 10 hits
ProtoNetiSearch...

Entry informationi

Entry nameiINADL_HUMAN
AccessioniPrimary (citable) accession number: Q8NI35
Secondary accession number(s): O15249
, O43742, O60833, Q5VUA5, Q5VUA6, Q5VUA7, Q5VUA8, Q5VUA9, Q5VUB0, Q8WU78, Q9H3N9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: October 17, 2006
Last modified: November 7, 2018
This is version 152 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again