Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-31 receptor subunit alpha

Gene

IL31RA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5 (PubMed:11877449, PubMed:14504285, PubMed:15627637, PubMed:15194700). May function in skin immunity (PubMed:15184896). Mediates IL31-induced itch, probably in a manner dependent on cation channels TRPA1 and TRPV1 (By similarity). Positively regulates numbers and cycling status of immature subsets of myeloid progenitor cells in bone marrow in vivo and enhances myeloid progenitor cell survival in vitro (By similarity).By similarity5 Publications

GO - Molecular functioni

  • cytokine binding Source: GO_Central
  • cytokine receptor activity Source: GO_Central
  • protein kinase binding Source: UniProtKB
  • transcription coactivator activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processImmunity

Enzyme and pathway databases

ReactomeiR-HSA-6788467 IL-6-type cytokine receptor ligand interactions
SignaLinkiQ8NI17
SIGNORiQ8NI17

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-31 receptor subunit alpha
Short name:
IL-31 receptor subunit alpha
Short name:
IL-31R subunit alpha
Short name:
IL-31R-alpha
Short name:
IL-31RA
Alternative name(s):
Cytokine receptor-like 3
GLM-R
Short name:
hGLM-R
Gp130-like monocyte receptor
Short name:
Gp130-like receptor
ZcytoR17
Gene namesi
Name:IL31RA
Synonyms:CRL3, GPL
ORF Names:UNQ6368/PRO21073/PRO21384
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000164509.13
HGNCiHGNC:18969 IL31RA
MIMi609510 gene
neXtProtiNX_Q8NI17

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 519ExtracellularSequence analysisAdd BLAST500
Transmembranei520 – 540HelicalSequence analysisAdd BLAST21
Topological domaini541 – 732CytoplasmicSequence analysisAdd BLAST192

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

Pathology & Biotechi

Involvement in diseasei

Amyloidosis, primary localized cutaneous, 2 (PLCA2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins.
See also OMIM:613955
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_065809489S → F in PLCA2. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi639Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-670 and A-708. 2 Publications1
Mutagenesisi639Y → F: Abrogates STAT5 activation. Mild effect on STAT1 activation. No effect on STAT3 activation. 2 Publications1
Mutagenesisi670Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-708. 2 Publications1
Mutagenesisi670Y → F: No effect on STAT3 and STAT5 activation. Mild effect on STAT1 activation. 2 Publications1
Mutagenesisi708Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-670. 2 Publications1
Mutagenesisi708Y → F: Abrogates STAT3 activation. Loss of interaction with STAT3. Mild effect on STAT1 activation. No effect on STAT5 activation. 2 Publications1

Keywords - Diseasei

Amyloidosis, Disease mutation

Organism-specific databases

DisGeNETi133396
MalaCardsiIL31RA
MIMi613955 phenotype
OpenTargetsiENSG00000164509
Orphaneti353220 Familial primary localized cutaneous amyloidosis
PharmGKBiPA134952624

Chemistry databases

GuidetoPHARMACOLOGYi1710

Polymorphism and mutation databases

BioMutaiIL31RA
DMDMi74730327

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 191 PublicationAdd BLAST19
ChainiPRO_000027457220 – 732Interleukin-31 receptor subunit alphaAdd BLAST713

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi37N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi93N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi166N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi187N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi277N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi283N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi395N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi455N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi504N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8NI17
PaxDbiQ8NI17
PeptideAtlasiQ8NI17
PRIDEiQ8NI17
ProteomicsDBi73801
73802 [Q8NI17-10]
73803 [Q8NI17-11]
73804 [Q8NI17-12]
73805 [Q8NI17-2]
73806 [Q8NI17-3]
73807 [Q8NI17-4]
73808 [Q8NI17-5]
73809 [Q8NI17-6]
73810 [Q8NI17-7]
73811 [Q8NI17-8]
73812 [Q8NI17-9]

PTM databases

iPTMnetiQ8NI17
PhosphoSitePlusiQ8NI17

Expressioni

Tissue specificityi

Expressed in CD14- and CD56-positive blood cells (PubMed:11877449). Expressed in macrophages (PubMed:16461143, PubMed:18439099). Expressed in keratinocytes (PubMed:21261663). Expressed in a subset of dorsal root ganglia neurons (at protein level) (PubMed:24373353). Expressed at low levels in testis, ovary, brain, prostate, placenta, thymus, bone marrow, trachea and skin (PubMed:15184896, PubMed:11877449, PubMed:14504285). Expressed in bronchial and alveolar epithelial cells and pulmonary fibroblasts (PubMed:18439099). Detected in all of the myelomonocytic lineage (PubMed:14504285). Isoform 6: Expressed at higher levels in lesional skin compared to healthy skin of atopic dermatitis patients (PubMed:24373353).7 Publications

Inductioni

Up-regulated in lesional keratinocytes of patients with atopic dermatitis (PubMed:16461143). Up-regulated by IFNG/IFN-gamma (PubMed:11877449, PubMed:14504285, PubMed:15184896, PubMed:21261663, PubMed:18439099). Up-regulated by bacterial lipopolysaccharides (LPS) (PubMed:11877449, PubMed:15184896, PubMed:14504285). Up-regulated by triacylated lipoprotein (Pam3Cys) (PubMed:21261663). Up-regulated by TGFB1/TGF-beta (PubMed:18439099).6 Publications

Gene expression databases

BgeeiENSG00000164509 Expressed in 82 organ(s), highest expression level in thoracic aorta
ExpressionAtlasiQ8NI17 baseline and differential
GenevisibleiQ8NI17 HS

Organism-specific databases

HPAiHPA051532
HPA068114

Interactioni

Subunit structurei

Heterodimer with OSMR. Interacts with JAK1 and STAT3.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi126357, 26 interactors
IntActiQ8NI17, 1 interactor
STRINGi9606.ENSP00000415900

Structurei

3D structure databases

ProteinModelPortaliQ8NI17
SMRiQ8NI17
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 122Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST99
Domaini124 – 225Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST102
Domaini223 – 315Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST93
Domaini319 – 416Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST98
Domaini421 – 515Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST95

Sequence similaritiesi

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJG6 Eukaryota
ENOG410YAI2 LUCA
GeneTreeiENSGT00550000074436
HOVERGENiHBG081788
InParanoidiQ8NI17
KOiK22630
OMAiCTWSPEK
OrthoDBiEOG091G01XM
PhylomeDBiQ8NI17
TreeFamiTF338122

Family and domain databases

CDDicd00063 FN3, 2 hits
Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR015321 TypeI_recpt_CBD
PfamiView protein in Pfam
PF00041 fn3, 2 hits
PF09240 IL6Ra-bind, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 4 hits
SUPFAMiSSF49265 SSF49265, 3 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits

Sequences (12+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 12 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NI17-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMWTWALWML PSLCKFSLAA LPAKPENISC VYYYRKNLTC TWSPGKETSY
60 70 80 90 100
TQYTVKRTYA FGEKHDNCTT NSSTSENRAS CSFFLPRITI PDNYTIEVEA
110 120 130 140 150
ENGDGVIKSH MTYWRLENIA KTEPPKIFRV KPVLGIKRMI QIEWIKPELA
160 170 180 190 200
PVSSDLKYTL RFRTVNSTSW MEVNFAKNRK DKNQTYNLTG LQPFTEYVIA
210 220 230 240 250
LRCAVKESKF WSDWSQEKMG MTEEEAPCGL ELWRVLKPAE ADGRRPVRLL
260 270 280 290 300
WKKARGAPVL EKTLGYNIWY YPESNTNLTE TMNTTNQQLE LHLGGESFWV
310 320 330 340 350
SMISYNSLGK SPVATLRIPA IQEKSFQCIE VMQACVAEDQ LVVKWQSSAL
360 370 380 390 400
DVNTWMIEWF PDVDSEPTTL SWESVSQATN WTIQQDKLKP FWCYNISVYP
410 420 430 440 450
MLHDKVGEPY SIQAYAKEGV PSEGPETKVE NIGVKTVTIT WKEIPKSERK
460 470 480 490 500
GIICNYTIFY QAEGGKGFSK TVNSSILQYG LESLKRKTSY IVQVMASTSA
510 520 530 540 550
GGTNGTSINF KTLSFSVFEI ILITSLIGGG LLILIILTVA YGLKKPNKLT
560 570 580 590 600
HLCWPTVPNP AESSIATWHG DDFKDKLNLK ESDDSVNTED RILKPCSTPS
610 620 630 640 650
DKLVIDKLVV NFGNVLQEIF TDEARTGQEN NLGGEKNGYV TCPFRPDCPL
660 670 680 690 700
GKSFEELPVS PEIPPRKSQY LRSRMPEGTR PEAKEQLLFS GQSLVPDHLC
710 720 730
EEGAPNPYLK NSVTAREFLV SEKLPEHTKG EV
Length:732
Mass (Da):82,954
Last modified:October 1, 2002 - v1
Checksum:i30F84BD3DD99A20E
GO
Isoform 2 (identifier: Q8NI17-2) [UniParc]FASTAAdd to basket
Also known as: v3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM

Show »
Length:764
Mass (Da):86,481
Checksum:iDC1D6BB2EA6AF15F
GO
Isoform 3 (identifier: Q8NI17-3) [UniParc]FASTAAdd to basket
Also known as: v4

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     639-649: YVTCPFRPDCP → TRILSSCPTSI
     650-732: Missing.

Show »
Length:662
Mass (Da):74,876
Checksum:iA49F6363C4B33582
GO
Isoform 4 (identifier: Q8NI17-4) [UniParc]FASTAAdd to basket
Also known as: v2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     325-732: Missing.

Show »
Length:356
Mass (Da):41,026
Checksum:iBF4DAD24F5048E1D
GO
Isoform 5 (identifier: Q8NI17-5) [UniParc]FASTAAdd to basket
Also known as: v1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     639-649: YVTCPFRPDCP → TRILSSCPTSI
     650-732: Missing.

Show »
Length:681
Mass (Da):77,047
Checksum:iC69CC4EF9AC55E42
GO
Isoform 6 (identifier: Q8NI17-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: Missing.

Note: No experimental confirmation available.
Show »
Length:622
Mass (Da):70,363
Checksum:i80E4A3592D040EC6
GO
Isoform 7 (identifier: Q8NI17-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     464-469: GGKGFS → A
     498-501: TSAG → YSGG
     502-732: Missing.

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):58,390
Checksum:i5DC85C59E170D44B
GO
Isoform 8 (identifier: Q8NI17-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     469-550: SKTVNSSILQ...YGLKKPNKLT → CKHAHSEVEK...RVLRKWKELL
     551-732: Missing.

Note: No experimental confirmation available.
Show »
Length:582
Mass (Da):66,605
Checksum:i5EC7B07B84B36057
GO
Isoform 9 (identifier: Q8NI17-9) [UniParc]FASTAAdd to basket
Also known as: GPL560, short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     548-732: Missing.

Note: Major isoform. Dominant negative IL31 receptor.
Show »
Length:560
Mass (Da):63,638
Checksum:iBDE67D9F753AED29
GO
Isoform 10 (identifier: Q8NI17-10) [UniParc]FASTAAdd to basket
Also known as: GPL610

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     593-598: LKPCST → RARYQA
     599-732: Missing.

Show »
Length:611
Mass (Da):69,491
Checksum:iEE437BBA84162525
GO
Isoform 11 (identifier: Q8NI17-11) [UniParc]FASTAAdd to basket
Also known as: GPL626

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     593-613: LKPCSTPSDKLVIDKLVVNFG → KGSELGTKLKFKPLISLDCAF
     614-732: Missing.

Show »
Length:626
Mass (Da):71,023
Checksum:iFA80DED660647A2F
GO
Isoform 12 (identifier: Q8NI17-12) [UniParc]FASTAAdd to basket
Also known as: GPL745, long

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM

Note: Major isoform. Functional IL31 receptor.
Show »
Length:745
Mass (Da):84,309
Checksum:iC4A17642CCC0549B
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGU4A0A0C4DGU4_HUMAN
Interleukin-31 receptor subunit alp...
IL31RA
324Annotation score:

Sequence cautioni

The sequence AAS86444 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAS86445 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_030328155D → N. Corresponds to variant dbSNP:rs13184107Ensembl.1
Natural variantiVAR_065809489S → F in PLCA2. 1 Publication1
Natural variantiVAR_030329497S → N. Corresponds to variant dbSNP:rs161704Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0227981 – 110Missing in isoform 6. 1 PublicationAdd BLAST110
Alternative sequenceiVSP_0227991M → MCIRQLKFFTTACVCECPQN ILSPQPSCVNLGM in isoform 2, isoform 4, isoform 5 and isoform 8. 2 Publications1
Alternative sequenceiVSP_0228001M → MKLSPQPSCVNLGM in isoform 3, isoform 7, isoform 9, isoform 10, isoform 11 and isoform 12. 2 Publications1
Alternative sequenceiVSP_022801325 – 732Missing in isoform 4. 1 PublicationAdd BLAST408
Alternative sequenceiVSP_022802464 – 469GGKGFS → A in isoform 7. 1 Publication6
Alternative sequenceiVSP_022803469 – 550SKTVN…PNKLT → CKHAHSEVEKNPKPQIDAMD RPVVGMAPPSHCDLQPGMNH LASLNLSENGAKSTHLLGFW GLNESEVTVPERRVLRKWKE LL in isoform 8. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_022804498 – 501TSAG → YSGG in isoform 7. 1 Publication4
Alternative sequenceiVSP_022805502 – 732Missing in isoform 7. 1 PublicationAdd BLAST231
Alternative sequenceiVSP_022806548 – 732Missing in isoform 9. CuratedAdd BLAST185
Alternative sequenceiVSP_022807551 – 732Missing in isoform 8. 1 PublicationAdd BLAST182
Alternative sequenceiVSP_022808593 – 613LKPCS…VVNFG → KGSELGTKLKFKPLISLDCA F in isoform 11. CuratedAdd BLAST21
Alternative sequenceiVSP_022809593 – 598LKPCST → RARYQA in isoform 10. Curated6
Alternative sequenceiVSP_022810599 – 732Missing in isoform 10. CuratedAdd BLAST134
Alternative sequenceiVSP_022811614 – 732Missing in isoform 11. CuratedAdd BLAST119
Alternative sequenceiVSP_022812639 – 649YVTCPFRPDCP → TRILSSCPTSI in isoform 3 and isoform 5. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_022813650 – 732Missing in isoform 3 and isoform 5. 1 PublicationAdd BLAST83

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF486620 mRNA Translation: AAM27958.1
AY499339 mRNA Translation: AAS86444.1 Different initiation.
AY499340 mRNA Translation: AAS86445.1 Different initiation.
AY499341 mRNA Translation: AAS86446.1
AY499342 mRNA Translation: AAS86447.1
AF106913 mRNA Translation: AAL36452.1
AY358117 mRNA Translation: AAQ88484.1
AY358740 mRNA Translation: AAQ89100.1
AC008914 Genomic DNA No translation available.
BC110490 mRNA Translation: AAI10491.1
CCDSiCCDS3970.2 [Q8NI17-2]
CCDS56365.1 [Q8NI17-5]
CCDS56366.1 [Q8NI17-3]
CCDS56367.1 [Q8NI17-6]
CCDS75244.1 [Q8NI17-8]
CCDS75245.1 [Q8NI17-12]
RefSeqiNP_001229565.1, NM_001242636.1 [Q8NI17-12]
NP_001229566.1, NM_001242637.1 [Q8NI17-5]
NP_001229567.1, NM_001242638.1 [Q8NI17-3]
NP_001229568.1, NM_001242639.1 [Q8NI17-6]
NP_001284499.1, NM_001297570.1 [Q8NI17-8]
NP_001284501.1, NM_001297572.1
NP_620586.3, NM_139017.5 [Q8NI17-2]
XP_011541444.1, XM_011543142.2 [Q8NI17-1]
XP_011541445.1, XM_011543143.2 [Q8NI17-3]
XP_011541446.1, XM_011543144.2 [Q8NI17-6]
UniGeneiHs.55378

Genome annotation databases

EnsembliENST00000297015; ENSP00000297015; ENSG00000164509 [Q8NI17-12]
ENST00000354961; ENSP00000347047; ENSG00000164509 [Q8NI17-3]
ENST00000359040; ENSP00000351935; ENSG00000164509 [Q8NI17-5]
ENST00000396834; ENSP00000380046; ENSG00000164509 [Q8NI17-3]
ENST00000396836; ENSP00000380048; ENSG00000164509 [Q8NI17-8]
ENST00000447346; ENSP00000415900; ENSG00000164509 [Q8NI17-2]
ENST00000490985; ENSP00000427533; ENSG00000164509 [Q8NI17-6]
GeneIDi133396
KEGGihsa:133396
UCSCiuc003jqk.3 human [Q8NI17-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF486620 mRNA Translation: AAM27958.1
AY499339 mRNA Translation: AAS86444.1 Different initiation.
AY499340 mRNA Translation: AAS86445.1 Different initiation.
AY499341 mRNA Translation: AAS86446.1
AY499342 mRNA Translation: AAS86447.1
AF106913 mRNA Translation: AAL36452.1
AY358117 mRNA Translation: AAQ88484.1
AY358740 mRNA Translation: AAQ89100.1
AC008914 Genomic DNA No translation available.
BC110490 mRNA Translation: AAI10491.1
CCDSiCCDS3970.2 [Q8NI17-2]
CCDS56365.1 [Q8NI17-5]
CCDS56366.1 [Q8NI17-3]
CCDS56367.1 [Q8NI17-6]
CCDS75244.1 [Q8NI17-8]
CCDS75245.1 [Q8NI17-12]
RefSeqiNP_001229565.1, NM_001242636.1 [Q8NI17-12]
NP_001229566.1, NM_001242637.1 [Q8NI17-5]
NP_001229567.1, NM_001242638.1 [Q8NI17-3]
NP_001229568.1, NM_001242639.1 [Q8NI17-6]
NP_001284499.1, NM_001297570.1 [Q8NI17-8]
NP_001284501.1, NM_001297572.1
NP_620586.3, NM_139017.5 [Q8NI17-2]
XP_011541444.1, XM_011543142.2 [Q8NI17-1]
XP_011541445.1, XM_011543143.2 [Q8NI17-3]
XP_011541446.1, XM_011543144.2 [Q8NI17-6]
UniGeneiHs.55378

3D structure databases

ProteinModelPortaliQ8NI17
SMRiQ8NI17
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126357, 26 interactors
IntActiQ8NI17, 1 interactor
STRINGi9606.ENSP00000415900

Chemistry databases

GuidetoPHARMACOLOGYi1710

PTM databases

iPTMnetiQ8NI17
PhosphoSitePlusiQ8NI17

Polymorphism and mutation databases

BioMutaiIL31RA
DMDMi74730327

Proteomic databases

MaxQBiQ8NI17
PaxDbiQ8NI17
PeptideAtlasiQ8NI17
PRIDEiQ8NI17
ProteomicsDBi73801
73802 [Q8NI17-10]
73803 [Q8NI17-11]
73804 [Q8NI17-12]
73805 [Q8NI17-2]
73806 [Q8NI17-3]
73807 [Q8NI17-4]
73808 [Q8NI17-5]
73809 [Q8NI17-6]
73810 [Q8NI17-7]
73811 [Q8NI17-8]
73812 [Q8NI17-9]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297015; ENSP00000297015; ENSG00000164509 [Q8NI17-12]
ENST00000354961; ENSP00000347047; ENSG00000164509 [Q8NI17-3]
ENST00000359040; ENSP00000351935; ENSG00000164509 [Q8NI17-5]
ENST00000396834; ENSP00000380046; ENSG00000164509 [Q8NI17-3]
ENST00000396836; ENSP00000380048; ENSG00000164509 [Q8NI17-8]
ENST00000447346; ENSP00000415900; ENSG00000164509 [Q8NI17-2]
ENST00000490985; ENSP00000427533; ENSG00000164509 [Q8NI17-6]
GeneIDi133396
KEGGihsa:133396
UCSCiuc003jqk.3 human [Q8NI17-1]

Organism-specific databases

CTDi133396
DisGeNETi133396
EuPathDBiHostDB:ENSG00000164509.13
GeneCardsiIL31RA
HGNCiHGNC:18969 IL31RA
HPAiHPA051532
HPA068114
MalaCardsiIL31RA
MIMi609510 gene
613955 phenotype
neXtProtiNX_Q8NI17
OpenTargetsiENSG00000164509
Orphaneti353220 Familial primary localized cutaneous amyloidosis
PharmGKBiPA134952624
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJG6 Eukaryota
ENOG410YAI2 LUCA
GeneTreeiENSGT00550000074436
HOVERGENiHBG081788
InParanoidiQ8NI17
KOiK22630
OMAiCTWSPEK
OrthoDBiEOG091G01XM
PhylomeDBiQ8NI17
TreeFamiTF338122

Enzyme and pathway databases

ReactomeiR-HSA-6788467 IL-6-type cytokine receptor ligand interactions
SignaLinkiQ8NI17
SIGNORiQ8NI17

Miscellaneous databases

ChiTaRSiIL31RA human
GeneWikiiIL31RA
GenomeRNAii133396
PROiPR:Q8NI17
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000164509 Expressed in 82 organ(s), highest expression level in thoracic aorta
ExpressionAtlasiQ8NI17 baseline and differential
GenevisibleiQ8NI17 HS

Family and domain databases

CDDicd00063 FN3, 2 hits
Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR015321 TypeI_recpt_CBD
PfamiView protein in Pfam
PF00041 fn3, 2 hits
PF09240 IL6Ra-bind, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 4 hits
SUPFAMiSSF49265 SSF49265, 3 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiIL31R_HUMAN
AccessioniPrimary (citable) accession number: Q8NI17
Secondary accession number(s): A6NIF8
, Q2TBA1, Q6EBC3, Q6EBC4, Q6EBC5, Q6EBC6, Q6UWL8, Q8WYJ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 1, 2002
Last modified: November 7, 2018
This is version 137 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again