Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q8NHY0 (B4GN2_HUMAN)

Entry version 138 (23 Feb 2022)
Sequence version 2 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Beta-1,4 N-acetylgalactosaminyltransferase 2

Gene

B4GALNT2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the synthesis of the Sd(a) antigen (Sia-alpha2,3-[GalNAc-beta1,4]Gal-beta1,4-GlcNAc), a carbohydrate determinant expressed on erythrocytes, the colonic mucosa and other tissues. Transfers a beta-1,4-linked GalNAc to the galactose residue of an alpha-2,3-sialylated chain.

2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.4.1.165, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8NHY0

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-446203, Asparagine N-linked glycosylation
R-HSA-9037629, Lewis blood group biosynthesis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q8NHY0

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00378

Protein family/group databases

Carbohydrate-Active enZymes

More...CAZyi		GT12, Glycosyltransferase Family 12

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Beta-1,4 N-acetylgalactosaminyltransferase 2 (EC:2.4.1.-)
Alternative name(s):
Sd(a) beta-1,4-GalNAc transferase
UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:B4GALNT2
Synonyms:GALGT2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:24136, B4GALNT2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		111730, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NHY0

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000167080

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 67CytoplasmicSequence analysisAdd BLAST67
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei68 – 88Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini89 – 566LumenalSequence analysisAdd BLAST478

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		124872

Open Targets

More...OpenTargetsi		ENSG00000167080

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134988070

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NHY0, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		B4GALNT2

Domain mapping of disease mutations (DMDM)

More...DMDMi		296434406

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000591031 – 566Beta-1,4 N-acetylgalactosaminyltransferase 2Add BLAST566

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NHY0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8NHY0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NHY0

PeptideAtlas

More...PeptideAtlasi		Q8NHY0

PRoteomics IDEntifications database

More...PRIDEi		Q8NHY0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		5593
73783 [Q8NHY0-1]
73784 [Q8NHY0-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8NHY0, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NHY0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NHY0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highly expressed in colon and to a lesser extent in kidney, stomach, ileum and rectum.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000167080, Expressed in colon and 52 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NHY0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000167080, Tissue enhanced (intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		125896, 5 interactors

Protein interaction database and analysis system

More...IntActi		Q8NHY0, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000300404

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NHY0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycosyltransferase 2 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QTK7, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000006679

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_036051_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NHY0

Identification of Orthologs from Complete Genome Data

More...OMAi		NHLQCST

Database of Orthologous Groups

More...OrthoDBi		363090at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NHY0

TreeFam database of animal gene trees

More...TreeFami		TF332297

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.90.550.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001173, Glyco_trans_2-like
IPR011143, GM2_synthase
IPR029044, Nucleotide-diphossugar_trans

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00535, Glycos_transf_2, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF000474, GM2_GD2_synthase, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53448, SSF53448, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8NHY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSAGFSVGK FHVEVASRGR ECVSGTPECG NRLGSAGFGA LCLELRGADP 
        60         70         80         90        100
AWGPFAAHGR SRRQGSRFLW LLKILVIILV LGIVGFMFGS MFLQAVFSSP 
       110        120        130        140        150
KPELPSPAPG VQKLKLLPEE RLRNLFSYDG IWLFPKNQCK CEANKEQGGY 
       160        170        180        190        200
NFQDAYGQSD LPAVKARRQA EFEHFQRREG LPRPLPLLVQ PNLPFGYPVH 
       210        220        230        240        250
GVEVMPLHTV PIPGLQFEGP DAPVYEVTLT ASLGTLNTLA DVPDSVVQGR 
       260        270        280        290        300
GQKQLIISTS DRKLLKFILQ HVTYTSTGYQ HQKVDIVSLE SRSSVAKFPV 
       310        320        330        340        350
TIRHPVIPKL YDPGPERKLR NLVTIATKTF LRPHKLMIML RSIREYYPDL 
       360        370        380        390        400
TVIVADDSQK PLEIKDNHVE YYTMPFGKGW FAGRNLAISQ VTTKYVLWVD 
       410        420        430        440        450
DDFLFNEETK IEVLVDVLEK TELDVVGGSV LGNVFQFKLL LEQSENGACL 
       460        470        480        490        500
HKRMGFFQPL DGFPSCVVTS GVVNFFLAHT ERLQRVGFDP RLQRVAHSEF 
       510        520        530        540        550
FIDGLGTLLV GSCPEVIIGH QSRSPVVDSE LAALEKTYNT YRSNTLTRVQ 
       560 
FKLALHYFKN HLQCAA
Length:566
Mass (Da):63,258
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i14B7DEBA30CB4E93
GO
Isoform 2 (identifier: Q8NHY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MGSAGFSVGKFHVEVASRGRECVSGTPECGNRLGSAGFGALCLELRGADPAWGPFAAHGRSRRQ → MTSG

Show »
Length:506
Mass (Da):57,032
Checksum:i8D03899FADBFB812
GO
Isoform 3 (identifier: Q8NHY0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-86: Missing.

Show »
Length:480
Mass (Da):54,203
Checksum:i0BBF724167537638
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04923840A → D3 PublicationsCorresponds to variant dbSNP:rs7207403Ensembl.1
Natural variantiVAR_035990459P → H in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_049239466C → R. Corresponds to variant dbSNP:rs7224888Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451951 – 86Missing in isoform 3. 1 PublicationAdd BLAST86
Alternative sequenceiVSP_0171311 – 64MGSAG…RSRRQ → MTSG in isoform 2. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ517770 mRNA Translation: CAD57148.1
AJ517771 mRNA Translation: CAD57149.1
AF510036 mRNA Translation: AAM34756.1
AK302876 mRNA Translation: BAG64056.1
AC069454 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94691.1
BC113675 mRNA Translation: AAI13676.1
BC113677 mRNA Translation: AAI13678.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11544.1 [Q8NHY0-1]
CCDS54139.1 [Q8NHY0-2]
CCDS54140.1 [Q8NHY0-3]

NCBI Reference Sequences

More...RefSeqi		NP_001152859.1, NM_001159387.1 [Q8NHY0-2]
NP_001152860.1, NM_001159388.1 [Q8NHY0-3]
NP_703147.2, NM_153446.2 [Q8NHY0-1]
XP_016879662.1, XM_017024173.1 [Q8NHY0-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000300404; ENSP00000300404; ENSG00000167080
ENST00000393354; ENSP00000377022; ENSG00000167080 [Q8NHY0-2]
ENST00000504681; ENSP00000425510; ENSG00000167080 [Q8NHY0-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		124872

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:124872

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000393354.7; ENSP00000377022.3; NM_001159387.2; NP_001152859.1 [Q8NHY0-2]

UCSC genome browser

More...UCSCi		uc002ion.3, human [Q8NHY0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - GTase

Beta-1,4 N-acetylgalactosaminyltransferase 2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ517770 mRNA Translation: CAD57148.1
AJ517771 mRNA Translation: CAD57149.1
AF510036 mRNA Translation: AAM34756.1
AK302876 mRNA Translation: BAG64056.1
AC069454 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94691.1
BC113675 mRNA Translation: AAI13676.1
BC113677 mRNA Translation: AAI13678.1
CCDSiCCDS11544.1 [Q8NHY0-1]
CCDS54139.1 [Q8NHY0-2]
CCDS54140.1 [Q8NHY0-3]
RefSeqiNP_001152859.1, NM_001159387.1 [Q8NHY0-2]
NP_001152860.1, NM_001159388.1 [Q8NHY0-3]
NP_703147.2, NM_153446.2 [Q8NHY0-1]
XP_016879662.1, XM_017024173.1 [Q8NHY0-3]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi125896, 5 interactors
IntActiQ8NHY0, 5 interactors
STRINGi9606.ENSP00000300404

Protein family/group databases

CAZyiGT12, Glycosyltransferase Family 12

PTM databases

GlyGeniQ8NHY0, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ8NHY0
PhosphoSitePlusiQ8NHY0

Genetic variation databases

BioMutaiB4GALNT2
DMDMi296434406

Proteomic databases

MassIVEiQ8NHY0
MaxQBiQ8NHY0
PaxDbiQ8NHY0
PeptideAtlasiQ8NHY0
PRIDEiQ8NHY0
ProteomicsDBi5593
73783 [Q8NHY0-1]
73784 [Q8NHY0-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2589, 79 antibodies from 22 providers

The DNASU plasmid repository

More...DNASUi		124872

Genome annotation databases

EnsembliENST00000300404; ENSP00000300404; ENSG00000167080
ENST00000393354; ENSP00000377022; ENSG00000167080 [Q8NHY0-2]
ENST00000504681; ENSP00000425510; ENSG00000167080 [Q8NHY0-3]
GeneIDi124872
KEGGihsa:124872
MANE-SelectiENST00000393354.7; ENSP00000377022.3; NM_001159387.2; NP_001152859.1 [Q8NHY0-2]
UCSCiuc002ion.3, human [Q8NHY0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		124872
DisGeNETi124872

GeneCards: human genes, protein and diseases

More...GeneCardsi		B4GALNT2
HGNCiHGNC:24136, B4GALNT2
HPAiENSG00000167080, Tissue enhanced (intestine)
MIMi111730, gene
neXtProtiNX_Q8NHY0
OpenTargetsiENSG00000167080
PharmGKBiPA134988070
VEuPathDBiHostDB:ENSG00000167080

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QTK7, Eukaryota
GeneTreeiENSGT00390000006679
HOGENOMiCLU_036051_1_0_1
InParanoidiQ8NHY0
OMAiNHLQCST
OrthoDBi363090at2759
PhylomeDBiQ8NHY0
TreeFamiTF332297

Enzyme and pathway databases

UniPathwayiUPA00378
BRENDAi2.4.1.165, 2681
PathwayCommonsiQ8NHY0
ReactomeiR-HSA-446203, Asparagine N-linked glycosylation
R-HSA-9037629, Lewis blood group biosynthesis
SignaLinkiQ8NHY0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		124872, 7 hits in 1037 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		B4GALNT2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		B4GALNT2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		124872
PharosiQ8NHY0, Tbio

Protein Ontology

More...PROi		PR:Q8NHY0
RNActiQ8NHY0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000167080, Expressed in colon and 52 other tissues
GenevisibleiQ8NHY0, HS

Family and domain databases

Gene3Di3.90.550.10, 1 hit
InterProiView protein in InterPro
IPR001173, Glyco_trans_2-like
IPR011143, GM2_synthase
IPR029044, Nucleotide-diphossugar_trans
PfamiView protein in Pfam
PF00535, Glycos_transf_2, 1 hit
PIRSFiPIRSF000474, GM2_GD2_synthase, 1 hit
SUPFAMiSSF53448, SSF53448, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiB4GN2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NHY0
Secondary accession number(s): B4DZE4, Q14CP1, Q86Y40
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2006
Last sequence update: May 18, 2010
Last modified: February 23, 2022
This is version 138 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again