Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-C motif chemokine 4-like

Gene

CCL4L1

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCytokine
Biological processChemotaxis, Inflammatory response

Enzyme and pathway databases

ReactomeiR-HSA-418594 G alpha (i) signalling events
SIGNORiQ8NHW4

Names & Taxonomyi

Protein namesi
Recommended name:
C-C motif chemokine 4-like
Alternative name(s):
Lymphocyte activation gene 1 protein
Short name:
LAG-1
Macrophage inflammatory protein 1-beta
Short name:
MIP-1-beta
Monocyte adherence-induced protein 5-alpha
Small-inducible cytokine A4-like
Gene namesi
Name:CCL4L1
Synonyms:CCL4L, LAG1, SCYA4L1
AND
Name:CCL4L2
Synonyms:CCL4L, SCYA4L2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000276070.4
HGNCiHGNC:10631 CCL4L1
HGNC:24066 CCL4L2
MIMi603782 gene
610757 gene
neXtProtiNX_Q8NHW4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi388372
6351
9560
OpenTargetsiENSG00000276070
PharmGKBiPA35563

Polymorphism and mutation databases

DMDMi74727347

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23By similarityAdd BLAST23
ChainiPRO_000032623424 – 92C-C motif chemokine 4-likeAdd BLAST69

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi34 ↔ 58By similarity
Disulfide bondi35 ↔ 74By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ8NHW4
PeptideAtlasiQ8NHW4
PRIDEiQ8NHW4
ProteomicsDBi73769
73770 [Q8NHW4-10]
73771 [Q8NHW4-2]
73772 [Q8NHW4-3]
73773 [Q8NHW4-4]
73774 [Q8NHW4-5]
73775 [Q8NHW4-6]
73776 [Q8NHW4-7]
73777 [Q8NHW4-8]
73778 [Q8NHW4-9]
TopDownProteomicsiQ8NHW4-4 [Q8NHW4-4]

Expressioni

Tissue specificityi

Detected in B-cells.1 Publication

Gene expression databases

BgeeiENSG00000276070
CleanExiHS_CCL4L1

Interactioni

Subunit structurei

Interacts with CCR5.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
SLC30A2Q9BRI33EBI-10271156,EBI-8644112

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114931, 1 interactor
IntActiQ8NHW4, 4 interactors
STRINGi9606.ENSP00000405533

Structurei

3D structure databases

ProteinModelPortaliQ8NHW4
SMRiQ8NHW4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J4I9 Eukaryota
ENOG410YXJU LUCA
GeneTreeiENSGT00900000140870
HOVERGENiHBG017871
InParanoidiQ8NHW4
KOiK12964
OMAiWVQEYVD
OrthoDBiEOG091G14Y2
PhylomeDBiQ8NHW4
TreeFamiTF334888

Family and domain databases

InterProiView protein in InterPro
IPR000827 Chemokine_CC_CS
IPR001811 Chemokine_IL8-like_dom
IPR036048 Interleukin_8-like_sf
PfamiView protein in Pfam
PF00048 IL8, 1 hit
SMARTiView protein in SMART
SM00199 SCY, 1 hit
SUPFAMiSSF54117 SSF54117, 1 hit
PROSITEiView protein in PROSITE
PS00472 SMALL_CYTOKINES_CC, 1 hit

Sequences (10)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Note: CCL4L1 and CCL4L2 genes differ in their non-coding regions. Thus, alternative splicing events differ between the two genes.
Isoform 1 (identifier: Q8NHW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLCVTVLSL LVLVAAFCSL ALSAPMGSDP PTACCFSYTA RKLPRNFVVD
60 70 80 90
YYETSSLCSQ PAVVFQTKRG KQVCADPSES WVQEYVYDLE LN
Length:92
Mass (Da):10,166
Last modified:October 1, 2002 - v1
Checksum:i4C8D01E926CDE882
GO
Isoform 2 (identifier: Q8NHW4-2) [UniParc]FASTAAdd to basket
Also known as: CCL4L2

The sequence of this isoform differs from the canonical sequence as follows:
     65-69: Missing.

Show »
Length:87
Mass (Da):9,505
Checksum:i8140E8AA4D95C05C
GO
Isoform 3 (identifier: Q8NHW4-3) [UniParc]FASTAAdd to basket
Also known as: CC4L2d

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

Show »
Length:96
Mass (Da):10,227
Checksum:iCA14E1C6FC2D1745
GO
Isoform 4 (identifier: Q8NHW4-4) [UniParc]FASTAAdd to basket
Also known as: CC4L2f

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → EWKLQGVCFQCCSGKDPIHQSCPTWTMVRQRKMPTTGKG

Show »
Length:103
Mass (Da):11,286
Checksum:i5603FE25DE1B08E9
GO
Isoform 5 (identifier: Q8NHW4-5) [UniParc]FASTAAdd to basket
Also known as: CC4L2b1, CC4L2b2

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: Missing.

Show »
Length:64
Mass (Da):6,850
Checksum:i60EA92F22897BEDF
GO
Isoform 6 (identifier: Q8NHW4-6) [UniParc]FASTAAdd to basket
Also known as: CC4L2e

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPHGPWSGRGRCLPQARDKAR

Show »
Length:86
Mass (Da):9,220
Checksum:iBE0C616BBA0CBDC8
GO
Isoform 7 (identifier: Q8NHW4-7) [UniParc]FASTAAdd to basket
Also known as: CC4L2d2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → KASKSALTPVSPGSRSTCMTWN

Show »
Length:47
Mass (Da):4,855
Checksum:iE0D5FB87C91506C9
GO
Isoform 8 (identifier: Q8NHW4-8) [UniParc]FASTAAdd to basket
Also known as: CC4L1d2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → NSKPKEASKSALTPVSPGSRSTCMTWN

Show »
Length:52
Mass (Da):5,410
Checksum:iC066A711CE38A507
GO
Isoform 9 (identifier: Q8NHW4-9) [UniParc]FASTAAdd to basket
Also known as: CC4L2bd2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → TKSSEWKLQG...QRKMPTTGKG

Show »
Length:68
Mass (Da):7,403
Checksum:i384D8E62C63366CA
GO
Isoform 10 (identifier: Q8NHW4-10) [UniParc]FASTAAdd to basket
Also known as: CC44L2c

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → YRESASSAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

Show »
Length:103
Mass (Da):11,008
Checksum:iDB0F566E66B545F7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti45R → H in AAH70310 (PubMed:15489334).Curated1

Polymorphismi

The copy number of the CC4L1 gene varies among individuals; most individuals have 1 to 6 copies in the diploid genome.1 Publication

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03262526 – 92MGSDP…DLELN → KASKSALTPVSPGSRSTCMT WN in isoform 7. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_03262626 – 92MGSDP…DLELN → NSKPKEASKSALTPVSPGSR STCMTWN in isoform 8. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_03262726 – 92MGSDP…DLELN → TKSSEWKLQGVCFQCCSGKD PIHQSCPTWTMVRQRKMPTT GKG in isoform 9. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_03262865 – 92FQTKR…DLELN → YRESASSAAPGRIPSTRAAP HGPWSGRGRCLPQARDKAR in isoform 10. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_03262965 – 92FQTKR…DLELN → AAPGRIPSTRAAPHGPWSGR GRCLPQARDKAR in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_03263065 – 92FQTKR…DLELN → EWKLQGVCFQCCSGKDPIHQ SCPTWTMVRQRKMPTTGKG in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_03263165 – 92Missing in isoform 5. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_03263265 – 92FQTKR…DLELN → AAPHGPWSGRGRCLPQARDK AR in isoform 6. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_03263365 – 69Missing in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY079147 Genomic DNA Translation: AAL87008.1
AY766460 Genomic DNA Translation: AAX07294.1
AY766460 Genomic DNA Translation: AAX07295.1
AY766461 Genomic DNA Translation: AAX07296.1
AY766461 Genomic DNA Translation: AAX07297.1
AY766461 Genomic DNA Translation: AAX07298.1
AY766461 Genomic DNA Translation: AAX07299.1
AY766461 Genomic DNA Translation: AAX07300.1
AY766461 Genomic DNA Translation: AAX07301.1
AY766461 Genomic DNA Translation: AAX07302.1
AY766461 Genomic DNA Translation: AAX07303.1
AY766461 Genomic DNA Translation: AAX07304.1
AY766447 mRNA Translation: AAX07306.1
AY766449 mRNA Translation: AAX07308.1
AY766450 mRNA Translation: AAX07309.1
AY766451 mRNA Translation: AAX07310.1
AY766452 mRNA Translation: AAX07311.1
AY766453 mRNA Translation: AAX07312.1
AY766454 mRNA Translation: AAX07313.1
AY766455 mRNA Translation: AAX07314.1
AY766456 mRNA Translation: AAX07315.1
AY766457 mRNA Translation: AAX07316.1
AY766458 mRNA Translation: AAX07317.1
BC070310 mRNA Translation: AAH70310.1
BC092445 mRNA Translation: AAH92445.1
BC130456 mRNA Translation: AAI30457.1
BC130458 mRNA Translation: AAI30459.1
BC144393 mRNA Translation: AAI44394.1
BC144394 mRNA Translation: AAI44395.1
BC171864 mRNA Translation: AAI71864.1
BC146944 mRNA Translation: AAI46945.1
BC146958 mRNA Translation: AAI46959.1
PIRiC60407
RefSeqiNP_001278397.1, NM_001291468.1 [Q8NHW4-2]
NP_001278398.1, NM_001291469.1 [Q8NHW4-5]
NP_001278399.1, NM_001291470.1 [Q8NHW4-5]
NP_001278400.1, NM_001291471.1 [Q8NHW4-10]
NP_001278401.1, NM_001291472.1 [Q8NHW4-3]
NP_001278402.1, NM_001291473.1 [Q8NHW4-6]
NP_001278403.1, NM_001291474.1 [Q8NHW4-9]
NP_001278404.1, NM_001291475.1 [Q8NHW4-4]
NP_996890.1, NM_207007.3 [Q8NHW4-1]
UniGeneiHs.449862
Hs.515183

Genome annotation databases

EnsembliENST00000610565; ENSP00000484498; ENSG00000276070 [Q8NHW4-6]
ENST00000613173; ENSP00000484455; ENSG00000276070 [Q8NHW4-9]
ENST00000615418; ENSP00000483206; ENSG00000276070 [Q8NHW4-3]
ENST00000617405; ENSP00000483330; ENSG00000276070 [Q8NHW4-4]
ENST00000617416; ENSP00000480089; ENSG00000276070 [Q8NHW4-5]
ENST00000620055; ENSP00000481323; ENSG00000276070 [Q8NHW4-7]
ENST00000620098; ENSP00000479774; ENSG00000276070 [Q8NHW4-10]
ENST00000620250; ENSP00000483609; ENSG00000276070 [Q8NHW4-1]
ENST00000620576; ENSP00000479354; ENSG00000276070 [Q8NHW4-2]
ENST00000620708; ENSP00000479126; ENSG00000275313 [Q8NHW4-1]
ENST00000620732; ENSP00000481969; ENSG00000276070 [Q8NHW4-5]
ENST00000631660; ENSP00000488687; ENSG00000275313 [Q8NHW4-7]
ENST00000632416; ENSP00000487859; ENSG00000275313 [Q8NHW4-2]
ENST00000632710; ENSP00000488758; ENSG00000275313 [Q8NHW4-5]
ENST00000634078; ENSP00000488231; ENSG00000275313 [Q8NHW4-6]
GeneIDi388372
9560
KEGGihsa:388372
hsa:9560
UCSCiuc002hlh.2 human [Q8NHW4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCC4L_HUMAN
AccessioniPrimary (citable) accession number: Q8NHW4
Secondary accession number(s): B2RUZ3
, B7ZMA8, Q50EM1, Q50EM2, Q50EM3, Q50EM4, Q50EM5, Q50EM6, Q50EM7, Q50EM8, Q569J2, Q6NSB0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 1, 2002
Last modified: June 20, 2018
This is version 131 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health