Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8NHW4 (CC4L_HUMAN)

Entry version 150 (02 Dec 2020)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Add a publicationFeedback
Protein

C-C motif chemokine 4-like

Gene

CCL4L1

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine
Biological processChemotaxis, Inflammatory response

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8NHW4

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-418594, G alpha (i) signalling events

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q8NHW4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-C motif chemokine 4-like
Alternative name(s):
Lymphocyte activation gene 1 protein
Short name:
LAG-1
Macrophage inflammatory protein 1-beta
Short name:
MIP-1-beta
Monocyte adherence-induced protein 5-alpha
Small-inducible cytokine A4-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCL4L1
Synonyms:CCL4L, LAG1, SCYA4L1
AND
Name:CCL4L2
Synonyms:CCL4L, SCYA4L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000276070.4

Human Gene Nomenclature Database

More...HGNCi		HGNC:10631, CCL4L1
HGNC:24066, CCL4L2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603782, gene
610757, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NHW4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		388372
9560

Open Targets

More...OpenTargetsi		ENSG00000276070

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NHW4, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HGNC:10631

Domain mapping of disease mutations (DMDM)

More...DMDMi		74727347

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23By similarityAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000032623424 – 92C-C motif chemokine 4-likeAdd BLAST69

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi34 ↔ 58By similarity
Disulfide bondi35 ↔ 74By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NHW4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NHW4

PeptideAtlas

More...PeptideAtlasi		Q8NHW4

PRoteomics IDEntifications database

More...PRIDEi		Q8NHW4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		73769 [Q8NHW4-1]
73770 [Q8NHW4-10]
73771 [Q8NHW4-2]
73772 [Q8NHW4-3]
73773 [Q8NHW4-4]
73774 [Q8NHW4-5]
73775 [Q8NHW4-6]
73776 [Q8NHW4-7]
73777 [Q8NHW4-8]
73778 [Q8NHW4-9]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q8NHW4-4 [Q8NHW4-4]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in B-cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000276070, Expressed in testis and 116 other tissues

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000276070, Tissue enhanced (blood, bone marrow, lung)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CCR5.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114931, 33 interactors

Protein interaction database and analysis system

More...IntActi		Q8NHW4, 36 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000483609

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NHW4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8NHW4

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the intercrine beta (chemokine CC) family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S8M4, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT01000000214365

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_2793265_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NHW4

Identification of Orthologs from Complete Genome Data

More...OMAi		VMDYYET

Database of Orthologous Groups

More...OrthoDBi		1575018at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NHW4

TreeFam database of animal gene trees

More...TreeFami		TF334888

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039809, Chemokine_b/g/d
IPR000827, Chemokine_CC_CS
IPR001811, Chemokine_IL8-like_dom
IPR036048, Interleukin_8-like_sf

The PANTHER Classification System

More...PANTHERi		PTHR12015, PTHR12015, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00048, IL8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00199, SCY, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54117, SSF54117, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00472, SMALL_CYTOKINES_CC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: CCL4L1 and CCL4L2 genes differ in their non-coding regions. Thus, alternative splicing events differ between the two genes.

This entry has 10 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NHW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLCVTVLSL LVLVAAFCSL ALSAPMGSDP PTACCFSYTA RKLPRNFVVD 
        60         70         80         90 
YYETSSLCSQ PAVVFQTKRG KQVCADPSES WVQEYVYDLE LN
Length:92
Mass (Da):10,166
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C8D01E926CDE882
GO
Isoform 2 (identifier: Q8NHW4-2) [UniParc]FASTAAdd to basket
Also known as: CCL4L2

The sequence of this isoform differs from the canonical sequence as follows:
     65-69: Missing.

Show »
Length:87
Mass (Da):9,505
Checksum:i8140E8AA4D95C05C
GO
Isoform 3 (identifier: Q8NHW4-3) [UniParc]FASTAAdd to basket
Also known as: CC4L2d

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

Show »
Length:96
Mass (Da):10,227
Checksum:iCA14E1C6FC2D1745
GO
Isoform 4 (identifier: Q8NHW4-4) [UniParc]FASTAAdd to basket
Also known as: CC4L2f

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → EWKLQGVCFQCCSGKDPIHQSCPTWTMVRQRKMPTTGKG

Show »
Length:103
Mass (Da):11,286
Checksum:i5603FE25DE1B08E9
GO
Isoform 5 (identifier: Q8NHW4-5) [UniParc]FASTAAdd to basket
Also known as: CC4L2b1, CC4L2b2

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: Missing.

Show »
Length:64
Mass (Da):6,850
Checksum:i60EA92F22897BEDF
GO
Isoform 6 (identifier: Q8NHW4-6) [UniParc]FASTAAdd to basket
Also known as: CC4L2e

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPHGPWSGRGRCLPQARDKAR

Show »
Length:86
Mass (Da):9,220
Checksum:iBE0C616BBA0CBDC8
GO
Isoform 7 (identifier: Q8NHW4-7) [UniParc]FASTAAdd to basket
Also known as: CC4L2d2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → KASKSALTPVSPGSRSTCMTWN

Show »
Length:47
Mass (Da):4,855
Checksum:iE0D5FB87C91506C9
GO
Isoform 8 (identifier: Q8NHW4-8) [UniParc]FASTAAdd to basket
Also known as: CC4L1d2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → NSKPKEASKSALTPVSPGSRSTCMTWN

Show »
Length:52
Mass (Da):5,410
Checksum:iC066A711CE38A507
GO
Isoform 9 (identifier: Q8NHW4-9) [UniParc]FASTAAdd to basket
Also known as: CC4L2bd2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → TKSSEWKLQG...QRKMPTTGKG

Show »
Length:68
Mass (Da):7,403
Checksum:i384D8E62C63366CA
GO
Isoform 10 (identifier: Q8NHW4-10) [UniParc]FASTAAdd to basket
Also known as: CC44L2c

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → YRESASSAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

Show »
Length:103
Mass (Da):11,008
Checksum:iDB0F566E66B545F7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0J9YY69A0A0J9YY69_HUMAN
C-C motif chemokine 4-like
CCL4L2
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YWH4A0A0J9YWH4_HUMAN
C-C motif chemokine 4-like
CCL4L2
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JLY3A0A0G2JLY3_HUMAN
C-C motif chemokine 4-like
CCL4L2
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YW77A0A0J9YW77_HUMAN
C-C motif chemokine 4-like
CCL4L2
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YWD1A0A0J9YWD1_HUMAN
C-C motif chemokine 4-like
CCL4L2
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti45R → H in AAH70310 (PubMed:15489334).Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

The copy number of the CC4L1 gene varies among individuals; most individuals have 1 to 6 copies in the diploid genome.1 Publication

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03262526 – 92MGSDP…DLELN → KASKSALTPVSPGSRSTCMT WN in isoform 7. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_03262626 – 92MGSDP…DLELN → NSKPKEASKSALTPVSPGSR STCMTWN in isoform 8. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_03262726 – 92MGSDP…DLELN → TKSSEWKLQGVCFQCCSGKD PIHQSCPTWTMVRQRKMPTT GKG in isoform 9. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_03262865 – 92FQTKR…DLELN → YRESASSAAPGRIPSTRAAP HGPWSGRGRCLPQARDKAR in isoform 10. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_03262965 – 92FQTKR…DLELN → AAPGRIPSTRAAPHGPWSGR GRCLPQARDKAR in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_03263065 – 92FQTKR…DLELN → EWKLQGVCFQCCSGKDPIHQ SCPTWTMVRQRKMPTTGKG in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_03263165 – 92Missing in isoform 5. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_03263265 – 92FQTKR…DLELN → AAPHGPWSGRGRCLPQARDK AR in isoform 6. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_03263365 – 69Missing in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY079147 Genomic DNA Translation: AAL87008.1
AY766460 Genomic DNA Translation: AAX07294.1
AY766460 Genomic DNA Translation: AAX07295.1
AY766461 Genomic DNA Translation: AAX07296.1
AY766461 Genomic DNA Translation: AAX07297.1
AY766461 Genomic DNA Translation: AAX07298.1
AY766461 Genomic DNA Translation: AAX07299.1
AY766461 Genomic DNA Translation: AAX07300.1
AY766461 Genomic DNA Translation: AAX07301.1
AY766461 Genomic DNA Translation: AAX07302.1
AY766461 Genomic DNA Translation: AAX07303.1
AY766461 Genomic DNA Translation: AAX07304.1
AY766447 mRNA Translation: AAX07306.1
AY766449 mRNA Translation: AAX07308.1
AY766450 mRNA Translation: AAX07309.1
AY766451 mRNA Translation: AAX07310.1
AY766452 mRNA Translation: AAX07311.1
AY766453 mRNA Translation: AAX07312.1
AY766454 mRNA Translation: AAX07313.1
AY766455 mRNA Translation: AAX07314.1
AY766456 mRNA Translation: AAX07315.1
AY766457 mRNA Translation: AAX07316.1
AY766458 mRNA Translation: AAX07317.1
BC070310 mRNA Translation: AAH70310.1
BC092445 mRNA Translation: AAH92445.1
BC130456 mRNA Translation: AAI30457.1
BC130458 mRNA Translation: AAI30459.1
BC144393 mRNA Translation: AAI44394.1
BC144394 mRNA Translation: AAI44395.1
BC171864 mRNA Translation: AAI71864.1
BC146944 mRNA Translation: AAI46945.1
BC146958 mRNA Translation: AAI46959.1

Protein sequence database of the Protein Information Resource

More...PIRi		C60407

NCBI Reference Sequences

More...RefSeqi		NP_001278397.1, NM_001291468.1 [Q8NHW4-2]
NP_001278398.1, NM_001291469.1 [Q8NHW4-5]
NP_001278399.1, NM_001291470.1 [Q8NHW4-5]
NP_001278400.1, NM_001291471.1 [Q8NHW4-10]
NP_001278401.1, NM_001291472.1 [Q8NHW4-3]
NP_001278402.1, NM_001291473.1 [Q8NHW4-6]
NP_001278403.1, NM_001291474.1 [Q8NHW4-9]
NP_001278404.1, NM_001291475.1 [Q8NHW4-4]
NP_996890.1, NM_207007.3 [Q8NHW4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000610565; ENSP00000484498; ENSG00000276070 [Q8NHW4-6]
ENST00000613173; ENSP00000484455; ENSG00000276070 [Q8NHW4-9]
ENST00000613828; ENSP00000484322; ENSG00000282604 [Q8NHW4-1]
ENST00000614182; ENSP00000482862; ENSG00000276125 [Q8NHW4-3]
ENST00000615418; ENSP00000483206; ENSG00000276070 [Q8NHW4-3]
ENST00000616100; ENSP00000484148; ENSG00000282604 [Q8NHW4-6]
ENST00000617405; ENSP00000483330; ENSG00000276070 [Q8NHW4-4]
ENST00000617416; ENSP00000480089; ENSG00000276070 [Q8NHW4-5]
ENST00000620055; ENSP00000481323; ENSG00000276070 [Q8NHW4-7]
ENST00000620063; ENSP00000478376; ENSG00000276125 [Q8NHW4-1]
ENST00000620098; ENSP00000479774; ENSG00000276070 [Q8NHW4-10]
ENST00000620250; ENSP00000483609; ENSG00000276070 [Q8NHW4-1]
ENST00000620576; ENSP00000479354; ENSG00000276070 [Q8NHW4-2]
ENST00000620708; ENSP00000479126; ENSG00000275313 [Q8NHW4-1]
ENST00000620732; ENSP00000481969; ENSG00000276070 [Q8NHW4-5]
ENST00000622783; ENSP00000479833; ENSG00000276125 [Q8NHW4-7]
ENST00000631554; ENSP00000487911; ENSG00000276125 [Q8NHW4-10]
ENST00000631660; ENSP00000488687; ENSG00000275313 [Q8NHW4-7]
ENST00000631768; ENSP00000488094; ENSG00000282604 [Q8NHW4-5]
ENST00000631782; ENSP00000488541; ENSG00000276125 [Q8NHW4-6]
ENST00000631808; ENSP00000487651; ENSG00000282604 [Q8NHW4-3]
ENST00000632416; ENSP00000487859; ENSG00000275313 [Q8NHW4-2]
ENST00000632480; ENSP00000488369; ENSG00000282604 [Q8NHW4-7]
ENST00000632699; ENSP00000488366; ENSG00000276125 [Q8NHW4-2]
ENST00000632710; ENSP00000488758; ENSG00000275313 [Q8NHW4-5]
ENST00000633309; ENSP00000488719; ENSG00000282604 [Q8NHW4-4]
ENST00000633550; ENSP00000488736; ENSG00000276125 [Q8NHW4-5]
ENST00000633849; ENSP00000487792; ENSG00000282604 [Q8NHW4-10]
ENST00000633897; ENSP00000488897; ENSG00000282604 [Q8NHW4-5]
ENST00000633927; ENSP00000488430; ENSG00000276125 [Q8NHW4-9]
ENST00000634027; ENSP00000488439; ENSG00000276125 [Q8NHW4-4]
ENST00000634078; ENSP00000488231; ENSG00000275313 [Q8NHW4-6]
ENST00000634191; ENSP00000487715; ENSG00000276125 [Q8NHW4-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		388372
9560

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:388372
hsa:9560

UCSC genome browser

More...UCSCi		uc002hlh.2, human [Q8NHW4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY079147 Genomic DNA Translation: AAL87008.1
AY766460 Genomic DNA Translation: AAX07294.1
AY766460 Genomic DNA Translation: AAX07295.1
AY766461 Genomic DNA Translation: AAX07296.1
AY766461 Genomic DNA Translation: AAX07297.1
AY766461 Genomic DNA Translation: AAX07298.1
AY766461 Genomic DNA Translation: AAX07299.1
AY766461 Genomic DNA Translation: AAX07300.1
AY766461 Genomic DNA Translation: AAX07301.1
AY766461 Genomic DNA Translation: AAX07302.1
AY766461 Genomic DNA Translation: AAX07303.1
AY766461 Genomic DNA Translation: AAX07304.1
AY766447 mRNA Translation: AAX07306.1
AY766449 mRNA Translation: AAX07308.1
AY766450 mRNA Translation: AAX07309.1
AY766451 mRNA Translation: AAX07310.1
AY766452 mRNA Translation: AAX07311.1
AY766453 mRNA Translation: AAX07312.1
AY766454 mRNA Translation: AAX07313.1
AY766455 mRNA Translation: AAX07314.1
AY766456 mRNA Translation: AAX07315.1
AY766457 mRNA Translation: AAX07316.1
AY766458 mRNA Translation: AAX07317.1
BC070310 mRNA Translation: AAH70310.1
BC092445 mRNA Translation: AAH92445.1
BC130456 mRNA Translation: AAI30457.1
BC130458 mRNA Translation: AAI30459.1
BC144393 mRNA Translation: AAI44394.1
BC144394 mRNA Translation: AAI44395.1
BC171864 mRNA Translation: AAI71864.1
BC146944 mRNA Translation: AAI46945.1
BC146958 mRNA Translation: AAI46959.1
PIRiC60407
RefSeqiNP_001278397.1, NM_001291468.1 [Q8NHW4-2]
NP_001278398.1, NM_001291469.1 [Q8NHW4-5]
NP_001278399.1, NM_001291470.1 [Q8NHW4-5]
NP_001278400.1, NM_001291471.1 [Q8NHW4-10]
NP_001278401.1, NM_001291472.1 [Q8NHW4-3]
NP_001278402.1, NM_001291473.1 [Q8NHW4-6]
NP_001278403.1, NM_001291474.1 [Q8NHW4-9]
NP_001278404.1, NM_001291475.1 [Q8NHW4-4]
NP_996890.1, NM_207007.3 [Q8NHW4-1]

3D structure databases

SMRiQ8NHW4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114931, 33 interactors
IntActiQ8NHW4, 36 interactors
STRINGi9606.ENSP00000483609

Polymorphism and mutation databases

BioMutaiHGNC:10631
DMDMi74727347

Proteomic databases

MassIVEiQ8NHW4
PaxDbiQ8NHW4
PeptideAtlasiQ8NHW4
PRIDEiQ8NHW4
ProteomicsDBi73769 [Q8NHW4-1]
73770 [Q8NHW4-10]
73771 [Q8NHW4-2]
73772 [Q8NHW4-3]
73773 [Q8NHW4-4]
73774 [Q8NHW4-5]
73775 [Q8NHW4-6]
73776 [Q8NHW4-7]
73777 [Q8NHW4-8]
73778 [Q8NHW4-9]
TopDownProteomicsiQ8NHW4-4 [Q8NHW4-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		72750, 109 antibodies

The DNASU plasmid repository

More...DNASUi		388372
9560

Genome annotation databases

EnsembliENST00000610565; ENSP00000484498; ENSG00000276070 [Q8NHW4-6]
ENST00000613173; ENSP00000484455; ENSG00000276070 [Q8NHW4-9]
ENST00000613828; ENSP00000484322; ENSG00000282604 [Q8NHW4-1]
ENST00000614182; ENSP00000482862; ENSG00000276125 [Q8NHW4-3]
ENST00000615418; ENSP00000483206; ENSG00000276070 [Q8NHW4-3]
ENST00000616100; ENSP00000484148; ENSG00000282604 [Q8NHW4-6]
ENST00000617405; ENSP00000483330; ENSG00000276070 [Q8NHW4-4]
ENST00000617416; ENSP00000480089; ENSG00000276070 [Q8NHW4-5]
ENST00000620055; ENSP00000481323; ENSG00000276070 [Q8NHW4-7]
ENST00000620063; ENSP00000478376; ENSG00000276125 [Q8NHW4-1]
ENST00000620098; ENSP00000479774; ENSG00000276070 [Q8NHW4-10]
ENST00000620250; ENSP00000483609; ENSG00000276070 [Q8NHW4-1]
ENST00000620576; ENSP00000479354; ENSG00000276070 [Q8NHW4-2]
ENST00000620708; ENSP00000479126; ENSG00000275313 [Q8NHW4-1]
ENST00000620732; ENSP00000481969; ENSG00000276070 [Q8NHW4-5]
ENST00000622783; ENSP00000479833; ENSG00000276125 [Q8NHW4-7]
ENST00000631554; ENSP00000487911; ENSG00000276125 [Q8NHW4-10]
ENST00000631660; ENSP00000488687; ENSG00000275313 [Q8NHW4-7]
ENST00000631768; ENSP00000488094; ENSG00000282604 [Q8NHW4-5]
ENST00000631782; ENSP00000488541; ENSG00000276125 [Q8NHW4-6]
ENST00000631808; ENSP00000487651; ENSG00000282604 [Q8NHW4-3]
ENST00000632416; ENSP00000487859; ENSG00000275313 [Q8NHW4-2]
ENST00000632480; ENSP00000488369; ENSG00000282604 [Q8NHW4-7]
ENST00000632699; ENSP00000488366; ENSG00000276125 [Q8NHW4-2]
ENST00000632710; ENSP00000488758; ENSG00000275313 [Q8NHW4-5]
ENST00000633309; ENSP00000488719; ENSG00000282604 [Q8NHW4-4]
ENST00000633550; ENSP00000488736; ENSG00000276125 [Q8NHW4-5]
ENST00000633849; ENSP00000487792; ENSG00000282604 [Q8NHW4-10]
ENST00000633897; ENSP00000488897; ENSG00000282604 [Q8NHW4-5]
ENST00000633927; ENSP00000488430; ENSG00000276125 [Q8NHW4-9]
ENST00000634027; ENSP00000488439; ENSG00000276125 [Q8NHW4-4]
ENST00000634078; ENSP00000488231; ENSG00000275313 [Q8NHW4-6]
ENST00000634191; ENSP00000487715; ENSG00000276125 [Q8NHW4-5]
GeneIDi388372
9560
KEGGihsa:388372
hsa:9560
UCSCiuc002hlh.2, human [Q8NHW4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		388372
9560
DisGeNETi388372
9560
EuPathDBiHostDB:ENSG00000276070.4

GeneCards: human genes, protein and diseases

More...GeneCardsi		CCL4L1
CCL4L2
HGNCiHGNC:10631, CCL4L1
HGNC:24066, CCL4L2
HPAiENSG00000276070, Tissue enhanced (blood, bone marrow, lung)
MIMi603782, gene
610757, gene
neXtProtiNX_Q8NHW4
OpenTargetsiENSG00000276070

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S8M4, Eukaryota
GeneTreeiENSGT01000000214365
HOGENOMiCLU_2793265_0_0_1
InParanoidiQ8NHW4
OMAiVMDYYET
OrthoDBi1575018at2759
PhylomeDBiQ8NHW4
TreeFamiTF334888

Enzyme and pathway databases

PathwayCommonsiQ8NHW4
ReactomeiR-HSA-418594, G alpha (i) signalling events
SIGNORiQ8NHW4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		388372, 2 hits in 82 CRISPR screens
9560, 3 hits in 470 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CCL4L2, human
PharosiQ8NHW4, Tbio

Protein Ontology

More...PROi		PR:Q8NHW4
RNActiQ8NHW4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000276070, Expressed in testis and 116 other tissues

Family and domain databases

InterProiView protein in InterPro
IPR039809, Chemokine_b/g/d
IPR000827, Chemokine_CC_CS
IPR001811, Chemokine_IL8-like_dom
IPR036048, Interleukin_8-like_sf
PANTHERiPTHR12015, PTHR12015, 1 hit
PfamiView protein in Pfam
PF00048, IL8, 1 hit
SMARTiView protein in SMART
SM00199, SCY, 1 hit
SUPFAMiSSF54117, SSF54117, 1 hit
PROSITEiView protein in PROSITE
PS00472, SMALL_CYTOKINES_CC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC4L_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NHW4
Secondary accession number(s): B2RUZ3
, B7ZMA8, Q50EM1, Q50EM2, Q50EM3, Q50EM4, Q50EM5, Q50EM6, Q50EM7, Q50EM8, Q569J2, Q6NSB0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 1, 2002
Last modified: December 2, 2020
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again