UniProtKB - Q8NHW4 (CC4L_HUMAN)
Functioni
GO - Molecular functioni
- CCR chemokine receptor binding Source: GO_Central
- chemokine activity Source: GO_Central
GO - Biological processi
- cellular response to interferon-gamma Source: GO_Central
- cellular response to interleukin-1 Source: GO_Central
- cellular response to tumor necrosis factor Source: GO_Central
- chemokine-mediated signaling pathway Source: GO_Central
- eosinophil chemotaxis Source: GO_Central
- G protein-coupled receptor signaling pathway Source: GO_Central
- inflammatory response Source: GO_Central
- lymphocyte chemotaxis Source: GO_Central
- monocyte chemotaxis Source: GO_Central
- neutrophil chemotaxis Source: GO_Central
- positive regulation of ERK1 and ERK2 cascade Source: GO_Central
- positive regulation of GTPase activity Source: GO_Central
Keywordsi
Molecular function | Cytokine |
Biological process | Chemotaxis, Inflammatory response |
Enzyme and pathway databases
PathwayCommonsi | Q8NHW4 |
Reactomei | R-HSA-418594, G alpha (i) signalling events |
SIGNORi | Q8NHW4 |
Names & Taxonomyi
Protein namesi | Recommended name: C-C motif chemokine 4-likeAlternative name(s): Lymphocyte activation gene 1 protein Short name: LAG-1 Macrophage inflammatory protein 1-beta Short name: MIP-1-beta Monocyte adherence-induced protein 5-alpha Small-inducible cytokine A4-like |
Gene namesi | Name:CCL4L1 Synonyms:CCL4L, LAG1, SCYA4L1 AND Name:CCL4L2 Synonyms:CCL4L, SCYA4L2 |
Organismi | Homo sapiens (Human) |
Taxonomic identifieri | 9606 [NCBI] |
Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Proteomesi |
|
Organism-specific databases
EuPathDBi | HostDB:ENSG00000276070.4 |
HGNCi | HGNC:10631, CCL4L1 HGNC:24066, CCL4L2 |
MIMi | 603782, gene 610757, gene |
neXtProti | NX_Q8NHW4 |
Subcellular locationi
Extracellular region or secreted
- Secreted By similarity
Extracellular region or secreted
- extracellular space Source: GO_Central
Keywords - Cellular componenti
SecretedPathology & Biotechi
Organism-specific databases
DisGeNETi | 388372 9560 |
OpenTargetsi | ENSG00000276070 |
Miscellaneous databases
Pharosi | Q8NHW4, Tbio |
Polymorphism and mutation databases
BioMutai | HGNC:10631 |
DMDMi | 74727347 |
PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Signal peptidei | 1 – 23 | By similarityAdd BLAST | 23 | |
ChainiPRO_0000326234 | 24 – 92 | C-C motif chemokine 4-likeAdd BLAST | 69 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Disulfide bondi | 34 ↔ 58 | By similarity | ||
Disulfide bondi | 35 ↔ 74 | By similarity |
Keywords - PTMi
Disulfide bondProteomic databases
MassIVEi | Q8NHW4 |
PaxDbi | Q8NHW4 |
PeptideAtlasi | Q8NHW4 |
PRIDEi | Q8NHW4 |
ProteomicsDBi | 73769 [Q8NHW4-1] 73770 [Q8NHW4-10] 73771 [Q8NHW4-2] 73772 [Q8NHW4-3] 73773 [Q8NHW4-4] 73774 [Q8NHW4-5] 73775 [Q8NHW4-6] 73776 [Q8NHW4-7] 73777 [Q8NHW4-8] 73778 [Q8NHW4-9] |
TopDownProteomicsi | Q8NHW4-4 [Q8NHW4-4] |
Expressioni
Tissue specificityi
Gene expression databases
Bgeei | ENSG00000276070, Expressed in testis and 116 other tissues |
Organism-specific databases
HPAi | ENSG00000276070, Tissue enhanced (blood, bone marrow, lung) |
Interactioni
Subunit structurei
Interacts with CCR5.
1 PublicationBinary interactionsi
Hide detailsQ8NHW4
GO - Molecular functioni
- CCR chemokine receptor binding Source: GO_Central
- chemokine activity Source: GO_Central
Protein-protein interaction databases
BioGRIDi | 114931, 33 interactors |
IntActi | Q8NHW4, 36 interactors |
STRINGi | 9606.ENSP00000483609 |
Miscellaneous databases
RNActi | Q8NHW4, protein |
Family & Domainsi
Sequence similaritiesi
Keywords - Domaini
SignalPhylogenomic databases
eggNOGi | ENOG502S8M4, Eukaryota |
GeneTreei | ENSGT01000000214365 |
HOGENOMi | CLU_2793265_0_0_1 |
InParanoidi | Q8NHW4 |
OMAi | VMDYYET |
OrthoDBi | 1575018at2759 |
PhylomeDBi | Q8NHW4 |
TreeFami | TF334888 |
Family and domain databases
InterProi | View protein in InterPro IPR039809, Chemokine_b/g/d IPR000827, Chemokine_CC_CS IPR001811, Chemokine_IL8-like_dom IPR036048, Interleukin_8-like_sf |
PANTHERi | PTHR12015, PTHR12015, 1 hit |
Pfami | View protein in Pfam PF00048, IL8, 1 hit |
SMARTi | View protein in SMART SM00199, SCY, 1 hit |
SUPFAMi | SSF54117, SSF54117, 1 hit |
PROSITEi | View protein in PROSITE PS00472, SMALL_CYTOKINES_CC, 1 hit |
s (10+)i Sequence
Sequence statusi: Complete.
: The displayed sequence is further processed into a mature form. Sequence processingi
This entry describes 10 produced by isoformsialternative splicing. AlignAdd to basketThis entry has 10 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All
This isoform has been chosen as the sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. canonicali
10 20 30 40 50
MKLCVTVLSL LVLVAAFCSL ALSAPMGSDP PTACCFSYTA RKLPRNFVVD
60 70 80 90
YYETSSLCSQ PAVVFQTKRG KQVCADPSES WVQEYVYDLE LN
The sequence of this isoform differs from the canonical sequence as follows:
65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → YRESASSAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR
Computationally mapped potential isoform sequencesi
There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basketA0A0J9YY69 | A0A0J9YY69_HUMAN | C-C motif chemokine 4-like | CCL4L2 | 96 | Annotation score: | ||
A0A0J9YWH4 | A0A0J9YWH4_HUMAN | C-C motif chemokine 4-like | CCL4L2 | 103 | Annotation score: | ||
A0A0G2JLY3 | A0A0G2JLY3_HUMAN | C-C motif chemokine 4-like | CCL4L2 | 92 | Annotation score: | ||
A0A0J9YW77 | A0A0J9YW77_HUMAN | C-C motif chemokine 4-like | CCL4L2 | 103 | Annotation score: | ||
A0A0J9YWD1 | A0A0J9YWD1_HUMAN | C-C motif chemokine 4-like | CCL4L2 | 68 | Annotation score: |
Experimental Info
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Sequence conflicti | 45 | R → H in AAH70310 (PubMed:15489334).Curated | 1 |
Polymorphismi
Alternative sequence
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Alternative sequenceiVSP_032625 | 26 – 92 | MGSDP…DLELN → KASKSALTPVSPGSRSTCMT WN in isoform 7. 1 PublicationAdd BLAST | 67 | |
Alternative sequenceiVSP_032626 | 26 – 92 | MGSDP…DLELN → NSKPKEASKSALTPVSPGSR STCMTWN in isoform 8. 1 PublicationAdd BLAST | 67 | |
Alternative sequenceiVSP_032627 | 26 – 92 | MGSDP…DLELN → TKSSEWKLQGVCFQCCSGKD PIHQSCPTWTMVRQRKMPTT GKG in isoform 9. 1 PublicationAdd BLAST | 67 | |
Alternative sequenceiVSP_032628 | 65 – 92 | FQTKR…DLELN → YRESASSAAPGRIPSTRAAP HGPWSGRGRCLPQARDKAR in isoform 10. 1 PublicationAdd BLAST | 28 | |
Alternative sequenceiVSP_032629 | 65 – 92 | FQTKR…DLELN → AAPGRIPSTRAAPHGPWSGR GRCLPQARDKAR in isoform 3. 1 PublicationAdd BLAST | 28 | |
Alternative sequenceiVSP_032630 | 65 – 92 | FQTKR…DLELN → EWKLQGVCFQCCSGKDPIHQ SCPTWTMVRQRKMPTTGKG in isoform 4. 1 PublicationAdd BLAST | 28 | |
Alternative sequenceiVSP_032631 | 65 – 92 | Missing in isoform 5. 2 PublicationsAdd BLAST | 28 | |
Alternative sequenceiVSP_032632 | 65 – 92 | FQTKR…DLELN → AAPHGPWSGRGRCLPQARDK AR in isoform 6. 1 PublicationAdd BLAST | 28 | |
Alternative sequenceiVSP_032633 | 65 – 69 | Missing in isoform 2. 1 Publication | 5 |
Sequence databases
Genome annotation databases
Keywords - Coding sequence diversityi
Alternative splicingSimilar proteinsi
Cross-referencesi
Sequence databases
3D structure databases
SMRi | Q8NHW4 |
ModBasei | Search... |
Protein-protein interaction databases
BioGRIDi | 114931, 33 interactors |
IntActi | Q8NHW4, 36 interactors |
STRINGi | 9606.ENSP00000483609 |
Polymorphism and mutation databases
BioMutai | HGNC:10631 |
DMDMi | 74727347 |
Proteomic databases
MassIVEi | Q8NHW4 |
PaxDbi | Q8NHW4 |
PeptideAtlasi | Q8NHW4 |
PRIDEi | Q8NHW4 |
ProteomicsDBi | 73769 [Q8NHW4-1] 73770 [Q8NHW4-10] 73771 [Q8NHW4-2] 73772 [Q8NHW4-3] 73773 [Q8NHW4-4] 73774 [Q8NHW4-5] 73775 [Q8NHW4-6] 73776 [Q8NHW4-7] 73777 [Q8NHW4-8] 73778 [Q8NHW4-9] |
TopDownProteomicsi | Q8NHW4-4 [Q8NHW4-4] |
Protocols and materials databases
Antibodypediai | 72750, 109 antibodies |
DNASUi | 388372 9560 |
Genome annotation databases
Organism-specific databases
CTDi | 388372 9560 |
DisGeNETi | 388372 9560 |
EuPathDBi | HostDB:ENSG00000276070.4 |
GeneCardsi | CCL4L1 CCL4L2 |
HGNCi | HGNC:10631, CCL4L1 HGNC:24066, CCL4L2 |
HPAi | ENSG00000276070, Tissue enhanced (blood, bone marrow, lung) |
MIMi | 603782, gene 610757, gene |
neXtProti | NX_Q8NHW4 |
OpenTargetsi | ENSG00000276070 |
GenAtlasi | Search... |
Phylogenomic databases
eggNOGi | ENOG502S8M4, Eukaryota |
GeneTreei | ENSGT01000000214365 |
HOGENOMi | CLU_2793265_0_0_1 |
InParanoidi | Q8NHW4 |
OMAi | VMDYYET |
OrthoDBi | 1575018at2759 |
PhylomeDBi | Q8NHW4 |
TreeFami | TF334888 |
Enzyme and pathway databases
PathwayCommonsi | Q8NHW4 |
Reactomei | R-HSA-418594, G alpha (i) signalling events |
SIGNORi | Q8NHW4 |
Miscellaneous databases
BioGRID-ORCSi | 388372, 2 hits in 82 CRISPR screens 9560, 3 hits in 470 CRISPR screens |
ChiTaRSi | CCL4L2, human |
Pharosi | Q8NHW4, Tbio |
PROi | PR:Q8NHW4 |
RNActi | Q8NHW4, protein |
SOURCEi | Search... |
Gene expression databases
Bgeei | ENSG00000276070, Expressed in testis and 116 other tissues |
Family and domain databases
InterProi | View protein in InterPro IPR039809, Chemokine_b/g/d IPR000827, Chemokine_CC_CS IPR001811, Chemokine_IL8-like_dom IPR036048, Interleukin_8-like_sf |
PANTHERi | PTHR12015, PTHR12015, 1 hit |
Pfami | View protein in Pfam PF00048, IL8, 1 hit |
SMARTi | View protein in SMART SM00199, SCY, 1 hit |
SUPFAMi | SSF54117, SSF54117, 1 hit |
PROSITEi | View protein in PROSITE PS00472, SMALL_CYTOKINES_CC, 1 hit |
ProtoNeti | Search... |
MobiDBi | Search... |
Entry informationi
Entry namei | CC4L_HUMAN | |
Accessioni | Q8NHW4Primary (citable) accession number: Q8NHW4 Secondary accession number(s): B2RUZ3 Q6NSB0 | |
Entry historyi | Integrated into UniProtKB/Swiss-Prot: | March 18, 2008 |
Last sequence update: | October 1, 2002 | |
Last modified: | December 2, 2020 | |
This is version 150 of the entry and version 1 of the sequence. See complete history. | ||
Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
Annotation program | Chordata Protein Annotation Program | |
Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. |
Miscellaneousi
Keywords - Technical termi
Reference proteomeDocuments
- MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families - Human chromosome 17
Human chromosome 17: entries, gene names and cross-references to MIM