Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8NHQ8 (RASF8_HUMAN)

Entry version 155 (02 Dec 2020)
Sequence version 2 (21 Jun 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Ras association domain-containing protein 8

Gene

RASSF8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8NHQ8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras association domain-containing protein 8
Alternative name(s):
Carcinoma-associated protein HOJ-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RASSF8
Synonyms:C12orf2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000123094.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:13232, RASSF8

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608231, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NHQ8

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving RASSF8 is found in a complex type of synpolydactyly referred to as 3/3-prime/4 synpolydactyly associated with metacarpal and metatarsal synostoses. Reciprocal translocation t(12;22)(p11.2;q13.3) with FBLN1.1 Publication

Organism-specific databases

DisGeNET

More...DisGeNETi		11228
MIMi608180, phenotype

Open Targets

More...OpenTargetsi		ENSG00000123094

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25502

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NHQ8, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RASSF8

Domain mapping of disease mutations (DMDM)

More...DMDMi		68068057

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000898401 – 419Ras association domain-containing protein 8Add BLAST419

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei105PhosphoserineCombined sources1
Modified residuei129PhosphoserineCombined sources1
Modified residuei131PhosphothreonineCombined sources1
Modified residuei387PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8NHQ8

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8NHQ8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NHQ8

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8NHQ8

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NHQ8

PeptideAtlas

More...PeptideAtlasi		Q8NHQ8

PRoteomics IDEntifications database

More...PRIDEi		Q8NHQ8

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		73739 [Q8NHQ8-1]
73740 [Q8NHQ8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NHQ8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NHQ8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed as a 6.2 kb transcript. A 2.2 kb alternatively spliced transcript is expressed exclusively in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000123094, Expressed in testis and 215 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8NHQ8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NHQ8, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000123094, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116395, 55 interactors

Protein interaction database and analysis system

More...IntActi		Q8NHQ8, 50 interactors

Molecular INTeraction database

More...MINTi		Q8NHQ8

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000384491

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NHQ8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1419
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8NHQ8

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q8NHQ8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 82Ras-associatingPROSITE-ProRule annotationAdd BLAST82

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi181 – 290Glu-richAdd BLAST110

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1574, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182839

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_031151_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NHQ8

Identification of Orthologs from Complete Genome Data

More...OMAi		LRPQNDK

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NHQ8

TreeFam database of animal gene trees

More...TreeFami		TF318385

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR033593, N-RASSF
IPR000159, RA_dom
IPR033632, RASSF8
IPR029071, Ubiquitin-like_domsf

The PANTHER Classification System

More...PANTHERi		PTHR15286, PTHR15286, 1 hit
PTHR15286:SF12, PTHR15286:SF12, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00788, RA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00314, RA, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54236, SSF54236, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50200, RA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NHQ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELKVWVDGV QRIVCGVTEV TTCQEVVIAL AQAIGRTGRY TLIEKWRDTE 
        60         70         80         90        100
RHLAPHENPI ISLNKWGQYA SDVQLILRRT GPSLSERPTS DSVARIPERT 
       110        120        130        140        150
LYRQSLPPLA KLRPQIDKSI KRREPKRKSL TFTGGAKGLM DIFGKGKETE 
       160        170        180        190        200
FKQKVLNNCK TTADELKKLI RLQTEKLQSI EKQLESNEIE IRFWEQKYNS 
       210        220        230        240        250
NLEEEIVRLE QKIKRNDVEI EEEEFWENEL QIEQENEKQL KDQLQEIRQK 
       260        270        280        290        300
ITECENKLKD YLAQIRTMES GLEAEKLQRE VQEAQVNEEE VKGKIGKVKG 
       310        320        330        340        350
EIDIQGQQSL RLENGIKAVE RSLGQATKRL QDKEQELEQL TKELRQVNLQ 
       360        370        380        390        400
QFIQQTGTKV TVLPAEPIEI EASHADIERE APFQSGSLKR PGSSRQLPSN 
       410 
LRILQNPISS GFNPEGIYV
Length:419
Mass (Da):48,327
Last modified:June 21, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i409223F6BE1C204A
GO
Isoform 2 (identifier: Q8NHQ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     380-419: EAPFQSGSLKRPGSSRQLPSNLRILQNPISSGFNPEGIYV → GIIILSDKQECKD

Show »
Length:392
Mass (Da):45,446
Checksum:iADA799FFB41733AE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H0S5F5H0S5_HUMAN
Ras association domain-containing p...
RASSF8
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7J1F5H7J1_HUMAN
Ras association domain-containing p...
RASSF8
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YG85H0YG85_HUMAN
Ras association domain-containing p...
RASSF8
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6IB99Q6IB99_HUMAN
C12orf2 protein
RASSF8 C12orf2
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GYP8F5GYP8_HUMAN
Ras association domain-containing p...
RASSF8
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H8B9F5H8B9_HUMAN
Ras association domain-containing p...
RASSF8
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H8C5F5H8C5_HUMAN
Ras association domain-containing p...
RASSF8
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H343F5H343_HUMAN
Ras association domain-containing p...
RASSF8
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC95425 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti15C → Y in BAC98838 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_014248380 – 419EAPFQ…EGIYV → GIIILSDKQECKD in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB093206 mRNA Translation: BAC98838.1
AY665468 mRNA Translation: AAV54603.1
AK290055 mRNA Translation: BAF82744.1
CH471094 Genomic DNA Translation: EAW96523.1
BC030021 mRNA Translation: AAH30021.1
U82396 mRNA Translation: AAC95425.1 Frameshift.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS53765.1 [Q8NHQ8-1]
CCDS8705.1 [Q8NHQ8-2]

NCBI Reference Sequences

More...RefSeqi		NP_001158218.1, NM_001164746.1 [Q8NHQ8-1]
NP_001158219.1, NM_001164747.1 [Q8NHQ8-1]
NP_001158220.1, NM_001164748.1 [Q8NHQ8-1]
NP_009142.2, NM_007211.4 [Q8NHQ8-2]
XP_006719090.1, XM_006719027.2 [Q8NHQ8-1]
XP_006719091.1, XM_006719028.1 [Q8NHQ8-1]
XP_016874235.1, XM_017018746.1 [Q8NHQ8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000282884; ENSP00000282884; ENSG00000123094 [Q8NHQ8-1]
ENST00000381352; ENSP00000370756; ENSG00000123094 [Q8NHQ8-2]
ENST00000405154; ENSP00000384491; ENSG00000123094 [Q8NHQ8-1]
ENST00000541490; ENSP00000443096; ENSG00000123094 [Q8NHQ8-1]
ENST00000542865; ENSP00000439839; ENSG00000123094 [Q8NHQ8-1]
ENST00000615708; ENSP00000481417; ENSG00000123094 [Q8NHQ8-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11228

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:11228

UCSC genome browser

More...UCSCi		uc001rgx.4, human [Q8NHQ8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB093206 mRNA Translation: BAC98838.1
AY665468 mRNA Translation: AAV54603.1
AK290055 mRNA Translation: BAF82744.1
CH471094 Genomic DNA Translation: EAW96523.1
BC030021 mRNA Translation: AAH30021.1
U82396 mRNA Translation: AAC95425.1 Frameshift.
CCDSiCCDS53765.1 [Q8NHQ8-1]
CCDS8705.1 [Q8NHQ8-2]
RefSeqiNP_001158218.1, NM_001164746.1 [Q8NHQ8-1]
NP_001158219.1, NM_001164747.1 [Q8NHQ8-1]
NP_001158220.1, NM_001164748.1 [Q8NHQ8-1]
NP_009142.2, NM_007211.4 [Q8NHQ8-2]
XP_006719090.1, XM_006719027.2 [Q8NHQ8-1]
XP_006719091.1, XM_006719028.1 [Q8NHQ8-1]
XP_016874235.1, XM_017018746.1 [Q8NHQ8-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CS4NMR-A1-82[»]
SMRiQ8NHQ8
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116395, 55 interactors
IntActiQ8NHQ8, 50 interactors
MINTiQ8NHQ8
STRINGi9606.ENSP00000384491

PTM databases

iPTMnetiQ8NHQ8
PhosphoSitePlusiQ8NHQ8

Polymorphism and mutation databases

BioMutaiRASSF8
DMDMi68068057

Proteomic databases

EPDiQ8NHQ8
jPOSTiQ8NHQ8
MassIVEiQ8NHQ8
MaxQBiQ8NHQ8
PaxDbiQ8NHQ8
PeptideAtlasiQ8NHQ8
PRIDEiQ8NHQ8
ProteomicsDBi73739 [Q8NHQ8-1]
73740 [Q8NHQ8-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		24278, 348 antibodies

The DNASU plasmid repository

More...DNASUi		11228

Genome annotation databases

EnsembliENST00000282884; ENSP00000282884; ENSG00000123094 [Q8NHQ8-1]
ENST00000381352; ENSP00000370756; ENSG00000123094 [Q8NHQ8-2]
ENST00000405154; ENSP00000384491; ENSG00000123094 [Q8NHQ8-1]
ENST00000541490; ENSP00000443096; ENSG00000123094 [Q8NHQ8-1]
ENST00000542865; ENSP00000439839; ENSG00000123094 [Q8NHQ8-1]
ENST00000615708; ENSP00000481417; ENSG00000123094 [Q8NHQ8-2]
GeneIDi11228
KEGGihsa:11228
UCSCiuc001rgx.4, human [Q8NHQ8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		11228
DisGeNETi11228
EuPathDBiHostDB:ENSG00000123094.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		RASSF8
HGNCiHGNC:13232, RASSF8
HPAiENSG00000123094, Low tissue specificity
MIMi608180, phenotype
608231, gene
neXtProtiNX_Q8NHQ8
OpenTargetsiENSG00000123094
PharmGKBiPA25502

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1574, Eukaryota
GeneTreeiENSGT00950000182839
HOGENOMiCLU_031151_0_0_1
InParanoidiQ8NHQ8
OMAiLRPQNDK
PhylomeDBiQ8NHQ8
TreeFamiTF318385

Enzyme and pathway databases

PathwayCommonsiQ8NHQ8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		11228, 7 hits in 843 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RASSF8, human
EvolutionaryTraceiQ8NHQ8

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RASSF8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		11228
PharosiQ8NHQ8, Tbio

Protein Ontology

More...PROi		PR:Q8NHQ8
RNActiQ8NHQ8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000123094, Expressed in testis and 215 other tissues
ExpressionAtlasiQ8NHQ8, baseline and differential
GenevisibleiQ8NHQ8, HS

Family and domain databases

InterProiView protein in InterPro
IPR033593, N-RASSF
IPR000159, RA_dom
IPR033632, RASSF8
IPR029071, Ubiquitin-like_domsf
PANTHERiPTHR15286, PTHR15286, 1 hit
PTHR15286:SF12, PTHR15286:SF12, 1 hit
PfamiView protein in Pfam
PF00788, RA, 1 hit
SMARTiView protein in SMART
SM00314, RA, 1 hit
SUPFAMiSSF54236, SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200, RA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRASF8_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NHQ8
Secondary accession number(s): A8K1Z0
, O95647, Q5SCI2, Q76KB6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 9, 2003
Last sequence update: June 21, 2005
Last modified: December 2, 2020
This is version 155 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again