Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysine-specific demethylase 2B

Gene

KDM2B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Histone demethylase that demethylates 'Lys-4' and 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' and dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. Preferentially binds the transcribed region of ribosomal RNA and represses the transcription of ribosomal RNA genes which inhibits cell growth and proliferation. May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.2 Publications

Catalytic activityi

Protein N6,N6-dimethyl-L-lysine + 2 2-oxoglutarate + 2 O2 = protein L-lysine + 2 succinate + 2 formaldehyde + 2 CO2.1 Publication

Cofactori

Fe2+By similarityNote: Binds 1 Fe2+ ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei239SubstrateBy similarity1
Metal bindingi242Iron; catalyticPROSITE-ProRule annotation1
Metal bindingi244Iron; catalyticPROSITE-ProRule annotation1
Binding sitei259SubstrateBy similarity1
Metal bindingi314Iron; catalyticPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri606 – 652CXXC-typePROSITE-ProRule annotationAdd BLAST47
Zinc fingeri659 – 725PHD-typePROSITE-ProRule annotationAdd BLAST67

GO - Molecular functioni

  • DNA binding Source: UniProtKB
  • histone demethylase activity Source: BHF-UCL
  • histone demethylase activity (H3-K36 specific) Source: UniProtKB-EC
  • RNA polymerase II proximal promoter sequence-specific DNA binding Source: Ensembl
  • rRNA binding Source: UniProtKB-KW
  • zinc ion binding Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase, Repressor, RNA-binding, rRNA-binding
Biological processTranscription, Transcription regulation, Ubl conjugation pathway
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-3214842 HDMs demethylate histones
SignaLinkiQ8NHM5
SIGNORiQ8NHM5

Names & Taxonomyi

Protein namesi
Recommended name:
Lysine-specific demethylase 2B (EC:1.14.11.271 Publication)
Alternative name(s):
CXXC-type zinc finger protein 2
F-box and leucine-rich repeat protein 10
F-box protein FBL10
F-box/LRR-repeat protein 10
JmjC domain-containing histone demethylation protein 1B
Jumonji domain-containing EMSY-interactor methyltransferase motif protein
Short name:
Protein JEMMA
Protein-containing CXXC domain 2
[Histone-H3]-lysine-36 demethylase 1B
Gene namesi
Name:KDM2B
Synonyms:CXXC2, FBL10, FBXL10, JHDM1B, PCCX2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000089094.16
HGNCiHGNC:13610 KDM2B
MIMi609078 gene
neXtProtiNX_Q8NHM5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84678
OpenTargetsiENSG00000089094
PharmGKBiPA164721242

Chemistry databases

ChEMBLiCHEMBL3779760

Polymorphism and mutation databases

BioMutaiKDM2B
DMDMi51316032

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001198531 – 1336Lysine-specific demethylase 2BAdd BLAST1336

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei57PhosphoserineCombined sources1
Modified residuei474PhosphoserineCombined sources1
Modified residuei477PhosphoserineCombined sources1
Modified residuei493PhosphothreonineCombined sources1
Modified residuei497PhosphoserineCombined sources1
Cross-linki857Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki890Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei951PhosphoserineCombined sources1
Modified residuei975PhosphoserineCombined sources1
Modified residuei979PhosphoserineCombined sources1
Modified residuei1018PhosphoserineCombined sources1
Modified residuei1031PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8NHM5
MaxQBiQ8NHM5
PaxDbiQ8NHM5
PeptideAtlasiQ8NHM5
PRIDEiQ8NHM5
ProteomicsDBi73723
73724 [Q8NHM5-2]
73725 [Q8NHM5-3]
73726 [Q8NHM5-4]

PTM databases

iPTMnetiQ8NHM5
PhosphoSitePlusiQ8NHM5

Expressioni

Gene expression databases

BgeeiENSG00000089094 Expressed in 196 organ(s), highest expression level in female gonad
CleanExiHS_FBXL10
ExpressionAtlasiQ8NHM5 baseline and differential
GenevisibleiQ8NHM5 HS

Organism-specific databases

HPAiHPA071257

Interactioni

Subunit structurei

Directly interacts with SKP1 and CUL1.By similarity

Binary interactionsi

Protein-protein interaction databases

BioGridi124197, 26 interactors
CORUMiQ8NHM5
IntActiQ8NHM5, 12 interactors
STRINGi9606.ENSP00000366271

Chemistry databases

BindingDBiQ8NHM5

Structurei

Secondary structure

11336
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8NHM5
SMRiQ8NHM5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini178 – 346JmjCPROSITE-ProRule annotationAdd BLAST169
Domaini1059 – 1105F-boxAdd BLAST47
Repeati1093 – 1120LRR 1Add BLAST28
Repeati1133 – 1154LRR 2Add BLAST22
Repeati1156 – 1182LRR 3Add BLAST27
Repeati1222 – 1247LRR 4Add BLAST26
Repeati1248 – 1277LRR 5Add BLAST30
Repeati1278 – 1302LRR 6Add BLAST25
Repeati1303 – 1336LRR 7Add BLAST34

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili943 – 971Sequence analysisAdd BLAST29

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi409 – 430Glu-richAdd BLAST22
Compositional biasi1014 – 1056Pro-richAdd BLAST43

Domaini

The JmjC domain mediates demethylation activity (By similarity). It is also required for repression of ribosomal RNA genes.By similarity

Sequence similaritiesi

Belongs to the JHDM1 histone demethylase family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri606 – 652CXXC-typePROSITE-ProRule annotationAdd BLAST47
Zinc fingeri659 – 725PHD-typePROSITE-ProRule annotationAdd BLAST67

Keywords - Domaini

Coiled coil, Leucine-rich repeat, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1633 Eukaryota
KOG1947 Eukaryota
ENOG410XQXU LUCA
GeneTreeiENSGT00550000074396
HOGENOMiHOG000007396
HOVERGENiHBG051671
InParanoidiQ8NHM5
KOiK10276
OMAiNYDYKPR
OrthoDBiEOG091G00M1
PhylomeDBiQ8NHM5
TreeFamiTF106480

Family and domain databases

Gene3Di3.30.40.10, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR001810 F-box_dom
IPR003347 JmjC_dom
IPR006553 Leu-rich_rpt_Cys-con_subtyp
IPR032675 LRR_dom_sf
IPR002857 Znf_CXXC
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00646 F-box, 1 hit
PF16866 PHD_4, 1 hit
PF02008 zf-CXXC, 1 hit
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
SM00367 LRR_CC, 6 hits
SM00249 PHD, 1 hit
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit
PS51058 ZF_CXXC, 1 hit
PS50016 ZF_PHD_2, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NHM5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGPQMGGSA EDHPPRKRHA AEKQKKKTVI YTKCFEFESA TQRPIDRQRY
60 70 80 90 100
DENEDLSDVE EIVSVRGFSL EEKLRSQLYQ GDFVHAMEGK DFNYEYVQRE
110 120 130 140 150
ALRVPLIFRE KDGLGIKMPD PDFTVRDVKL LVGSRRLVDV MDVNTQKGTE
160 170 180 190 200
MSMSQFVRYY ETPEAQRDKL YNVISLEFSH TKLEHLVKRP TVVDLVDWVD
210 220 230 240 250
NMWPQHLKEK QTEATNAIAE MKYPKVKKYC LMSVKGCFTD FHIDFGGTSV
260 270 280 290 300
WYHVFRGGKI FWLIPPTLHN LALYEEWVLS GKQSDIFLGD RVERCQRIEL
310 320 330 340 350
KQGYTFFIPS GWIHAVYTPV DSLVFGGNIL HSFNVPMQLR IYEIEDRTRV
360 370 380 390 400
QPKFRYPFYY EMCWYVLERY VYCVTQRSHL TQEYQRESML IDAPRKPSID
410 420 430 440 450
GFSSDSWLEM EEEACDQQPQ EEEEKDEEGE GRDRAPKPPT DGSTSPTSTP
460 470 480 490 500
SEDQEALGKK PKAPALRFLK RTLSNESEES VKSTTLAVDY PKTPTGSPAT
510 520 530 540 550
EVSAKWTHLT EFELKGLKAL VEKLESLPEN KKCVPEGIED PQALLEGVKN
560 570 580 590 600
VLKEHADDDP SLAITGVPVV TWPKKTPKNR AVGRPKGKLG PASAVKLAAN
610 620 630 640 650
RTTAGARRRR TRCRKCEACL RTECGECHFC KDMKKFGGPG RMKQSCIMRQ
660 670 680 690 700
CIAPVLPHTA VCLVCGEAGK EDTVEEEEGK FNLMLMECSI CNEIIHPGCL
710 720 730 740 750
KIKESEGVVN DELPNCWECP KCNHAGKTGK QKRGPGFKYA SNLPGSLLKE
760 770 780 790 800
QKMNRDNKEG QEPAKRRSEC EEAPRRRSDE HSKKVPPDGL LRRKSDDVHL
810 820 830 840 850
RKKRKYEKPQ ELSGRKRASS LQTSPGSSSH LSPRPPLGSS LSPWWRSSLT
860 870 880 890 900
YFQQQLKPGK EDKLFRKKRR SWKNAEDRMA LANKPLRRFK QEPEDELPEA
910 920 930 940 950
PPKTRESDHS RSSSPTAGPS TEGAEGPEEK KKVKMRRKRR LPNKELSREL
960 970 980 990 1000
SKELNHEIQR TENSLANENQ QPIKSEPESE GEEPKRPPGI CERPHRFSKG
1010 1020 1030 1040 1050
LNGTPRELRH QLGPSLRSPP RVISRPPPSV SPPKCIQMER HVIRPPPISP
1060 1070 1080 1090 1100
PPDSLPLDDG AAHVMHREVW MAVFSYLSHQ DLCVCMRVCR TWNRWCCDKR
1110 1120 1130 1140 1150
LWTRIDLNHC KSITPLMLSG IIRRQPVSLD LSWTNISKKQ LSWLINRLPG
1160 1170 1180 1190 1200
LRDLVLSGCS WIAVSALCSS SCPLLRTLDV QWVEGLKDAQ MRDLLSPPTD
1210 1220 1230 1240 1250
NRPGQMDNRS KLRNIVELRL AGLDITDASL RLIIRHMPLL SKLHLSYCNH
1260 1270 1280 1290 1300
VTDQSINLLT AVGTTTRDSL TEINLSDCNK VTDQCLSFFK RCGNICHIDL
1310 1320 1330
RYCKQVTKEG CEQFIAEMSV SVQFGQVEEK LLQKLS
Length:1,336
Mass (Da):152,615
Last modified:October 1, 2002 - v1
Checksum:i3A1A17B8EA9EA953
GO
Isoform 2 (identifier: Q8NHM5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     730-730: K → KAYK
     1277-1336: DCNKVTDQCL...VEEKLLQKLS → ASLLGRVFGLQFWGICEPQARKNAGWA

Show »
Length:1,306
Mass (Da):149,034
Checksum:i3329D5375AD25930
GO
Isoform 3 (identifier: Q8NHM5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     856-868: LKPGKEDKLFRKK → Q
     1204-1204: G → GPG

Note: No experimental confirmation available.
Show »
Length:1,326
Mass (Da):151,328
Checksum:iBCBDAE3F675E017C
GO
Isoform 4 (identifier: Q8NHM5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MAGPQMGGSAEDHPPRKRHAAEKQKKKTVIYTKCFEFESATQ → MEAEKDSGRRL
     818-855: Missing.
     1320-1336: VSVQFGQVEEKLLQKLS → SFQGRSCSTTRLGDE

Note: No experimental confirmation available.
Show »
Length:1,265
Mass (Da):144,769
Checksum:i69C8C16EFDE3541C
GO
Isoform 5 (identifier: Q8NHM5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-117: Missing.
     654-676: PVLPHTAVCLVCGEAGKEDTVEE → TAIRSLISACPSSNAVETSVILT
     677-1336: Missing.

Note: No experimental confirmation available.
Show »
Length:559
Mass (Da):63,630
Checksum:i8D324402C781480D
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6SRV7F6SRV7_HUMAN
Lysine-specific demethylase 2B
KDM2B
706Annotation score:
A0A0C4DGG3A0A0C4DGG3_HUMAN
Lysine-specific demethylase 2B
KDM2B
704Annotation score:
F5H6N6F5H6N6_HUMAN
Lysine-specific demethylase 2B
KDM2B
154Annotation score:
F5GXW2F5GXW2_HUMAN
Lysine-specific demethylase 2B
KDM2B
123Annotation score:
F5H4A7F5H4A7_HUMAN
Lysine-specific demethylase 2B
KDM2B
171Annotation score:
F8WBN2F8WBN2_HUMAN
Lysine-specific demethylase 2B
KDM2B
510Annotation score:
F5GXC2F5GXC2_HUMAN
Lysine-specific demethylase 2B
KDM2B
180Annotation score:
F5H7T7F5H7T7_HUMAN
Lysine-specific demethylase 2B
KDM2B
97Annotation score:
F5H4X4F5H4X4_HUMAN
Lysine-specific demethylase 2B
KDM2B
125Annotation score:
S4R3G4S4R3G4_HUMAN
Lysine-specific demethylase 2B
KDM2B
507Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AAH08735 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55112 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55301 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC11159 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti864L → F in BAC11159 (Ref. 6) Curated1
Sequence conflicti1226T → R in BAC11159 (Ref. 6) Curated1
Sequence conflicti1295I → T in BAC11159 (Ref. 6) Curated1
Sequence conflicti1334K → R in BAC11159 (Ref. 6) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0573941 – 117Missing in isoform 5. 1 PublicationAdd BLAST117
Alternative sequenceiVSP_0431461 – 42MAGPQ…ESATQ → MEAEKDSGRRL in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_057395654 – 676PVLPH…DTVEE → TAIRSLISACPSSNAVETSV ILT in isoform 5. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_057396677 – 1336Missing in isoform 5. 1 PublicationAdd BLAST660
Alternative sequenceiVSP_011340730K → KAYK in isoform 2. 1 Publication1
Alternative sequenceiVSP_043147818 – 855Missing in isoform 4. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_017475856 – 868LKPGK…LFRKK → Q in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0174761204G → GPG in isoform 3. 1 Publication1
Alternative sequenceiVSP_0113411277 – 1336DCNKV…LQKLS → ASLLGRVFGLQFWGICEPQA RKNAGWA in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0431481320 – 1336VSVQF…LQKLS → SFQGRSCSTTRLGDE in isoform 4. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ459424 mRNA Translation: CAD30700.1
AK027440 mRNA Translation: BAB55112.1 Different initiation.
AK027692 mRNA Translation: BAB55301.1 Different initiation.
AK074718 mRNA Translation: BAC11159.1 Different initiation.
AK127328 mRNA Translation: BAG54483.1
AC048337 Genomic DNA No translation available.
AC073650 Genomic DNA No translation available.
AC145422 Genomic DNA No translation available.
KC877509 Genomic DNA No translation available.
BC008735 mRNA Translation: AAH08735.2 Different initiation.
BC115379 mRNA Translation: AAI15380.1
AL133572 mRNA Translation: CAB63721.2
AB031230 mRNA Translation: BAA97672.1
CCDSiCCDS41849.1 [Q8NHM5-4]
CCDS41850.1 [Q8NHM5-1]
PIRiT43477
RefSeqiNP_001005366.1, NM_001005366.1 [Q8NHM5-4]
NP_115979.3, NM_032590.4 [Q8NHM5-1]
UniGeneiHs.524800

Genome annotation databases

EnsembliENST00000377069; ENSP00000366269; ENSG00000089094 [Q8NHM5-4]
ENST00000377071; ENSP00000366271; ENSG00000089094 [Q8NHM5-1]
ENST00000611216; ENSP00000480847; ENSG00000089094 [Q8NHM5-5]
GeneIDi84678
KEGGihsa:84678
UCSCiuc058uhm.1 human [Q8NHM5-1]
uc058uhn.1 human

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ459424 mRNA Translation: CAD30700.1
AK027440 mRNA Translation: BAB55112.1 Different initiation.
AK027692 mRNA Translation: BAB55301.1 Different initiation.
AK074718 mRNA Translation: BAC11159.1 Different initiation.
AK127328 mRNA Translation: BAG54483.1
AC048337 Genomic DNA No translation available.
AC073650 Genomic DNA No translation available.
AC145422 Genomic DNA No translation available.
KC877509 Genomic DNA No translation available.
BC008735 mRNA Translation: AAH08735.2 Different initiation.
BC115379 mRNA Translation: AAI15380.1
AL133572 mRNA Translation: CAB63721.2
AB031230 mRNA Translation: BAA97672.1
CCDSiCCDS41849.1 [Q8NHM5-4]
CCDS41850.1 [Q8NHM5-1]
PIRiT43477
RefSeqiNP_001005366.1, NM_001005366.1 [Q8NHM5-4]
NP_115979.3, NM_032590.4 [Q8NHM5-1]
UniGeneiHs.524800

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4O64X-ray2.13A/B/C607-723[»]
5JH5X-ray2.55A1059-1336[»]
6BVAX-ray2.66E/F1060-1104[»]
ProteinModelPortaliQ8NHM5
SMRiQ8NHM5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124197, 26 interactors
CORUMiQ8NHM5
IntActiQ8NHM5, 12 interactors
STRINGi9606.ENSP00000366271

Chemistry databases

BindingDBiQ8NHM5
ChEMBLiCHEMBL3779760

PTM databases

iPTMnetiQ8NHM5
PhosphoSitePlusiQ8NHM5

Polymorphism and mutation databases

BioMutaiKDM2B
DMDMi51316032

Proteomic databases

EPDiQ8NHM5
MaxQBiQ8NHM5
PaxDbiQ8NHM5
PeptideAtlasiQ8NHM5
PRIDEiQ8NHM5
ProteomicsDBi73723
73724 [Q8NHM5-2]
73725 [Q8NHM5-3]
73726 [Q8NHM5-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377069; ENSP00000366269; ENSG00000089094 [Q8NHM5-4]
ENST00000377071; ENSP00000366271; ENSG00000089094 [Q8NHM5-1]
ENST00000611216; ENSP00000480847; ENSG00000089094 [Q8NHM5-5]
GeneIDi84678
KEGGihsa:84678
UCSCiuc058uhm.1 human [Q8NHM5-1]
uc058uhn.1 human

Organism-specific databases

CTDi84678
DisGeNETi84678
EuPathDBiHostDB:ENSG00000089094.16
GeneCardsiKDM2B
HGNCiHGNC:13610 KDM2B
HPAiHPA071257
MIMi609078 gene
neXtProtiNX_Q8NHM5
OpenTargetsiENSG00000089094
PharmGKBiPA164721242
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1633 Eukaryota
KOG1947 Eukaryota
ENOG410XQXU LUCA
GeneTreeiENSGT00550000074396
HOGENOMiHOG000007396
HOVERGENiHBG051671
InParanoidiQ8NHM5
KOiK10276
OMAiNYDYKPR
OrthoDBiEOG091G00M1
PhylomeDBiQ8NHM5
TreeFamiTF106480

Enzyme and pathway databases

ReactomeiR-HSA-3214842 HDMs demethylate histones
SignaLinkiQ8NHM5
SIGNORiQ8NHM5

Miscellaneous databases

ChiTaRSiKDM2B human
GenomeRNAii84678
PROiPR:Q8NHM5
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000089094 Expressed in 196 organ(s), highest expression level in female gonad
CleanExiHS_FBXL10
ExpressionAtlasiQ8NHM5 baseline and differential
GenevisibleiQ8NHM5 HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR001810 F-box_dom
IPR003347 JmjC_dom
IPR006553 Leu-rich_rpt_Cys-con_subtyp
IPR032675 LRR_dom_sf
IPR002857 Znf_CXXC
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00646 F-box, 1 hit
PF16866 PHD_4, 1 hit
PF02008 zf-CXXC, 1 hit
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
SM00367 LRR_CC, 6 hits
SM00249 PHD, 1 hit
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit
PS51058 ZF_CXXC, 1 hit
PS50016 ZF_PHD_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKDM2B_HUMAN
AccessioniPrimary (citable) accession number: Q8NHM5
Secondary accession number(s): A8MRS1
, Q1RLM7, Q8NCI2, Q96HC7, Q96SL0, Q96T03, Q9NS96, Q9UF75
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: October 1, 2002
Last modified: November 7, 2018
This is version 161 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again