Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q8NHM5 (KDM2B_HUMAN)

Entry version 183 (25 May 2022)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Lysine-specific demethylase 2B

Gene

KDM2B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone demethylase that demethylates 'Lys-4' and 'Lys-36' of histone H3, thereby playing a central role in histone code (PubMed:16362057, PubMed:17994099, PubMed:26237645).

Preferentially demethylates trimethylated H3 'Lys-4' and dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36' (PubMed:16362057, PubMed:17994099, PubMed:26237645).

Preferentially binds the transcribed region of ribosomal RNA and represses the transcription of ribosomal RNA genes which inhibits cell growth and proliferation (PubMed:16362057, PubMed:17994099).

May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex (Probable).

Curated3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Fe2+Note: Binds 1 Fe2+ ion per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Histone demethylase activity is inhibited by fumarate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei239SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi242Iron; catalyticPROSITE-ProRule annotation1
Metal bindingi244Iron; catalyticPROSITE-ProRule annotation1
Binding sitei259SubstrateBy similarity1
Metal bindingi314Iron; catalyticPROSITE-ProRule annotation1
Metal bindingi613Zinc 1PROSITE-ProRule annotationCombined sources1 Publication1
Metal bindingi616Zinc 1PROSITE-ProRule annotationCombined sources1 Publication1
Metal bindingi619Zinc 1PROSITE-ProRule annotationCombined sources1 Publication1
Metal bindingi624Zinc 2PROSITE-ProRule annotationCombined sources1 Publication1
Metal bindingi627Zinc 2PROSITE-ProRule annotationCombined sources1 Publication1
Metal bindingi630Zinc 2PROSITE-ProRule annotationCombined sources1 Publication1
Metal bindingi646Zinc 2PROSITE-ProRule annotationCombined sources1 Publication1
Metal bindingi651Zinc 1PROSITE-ProRule annotation1
Metal bindingi662ZincCombined sources1 Publication1
Metal bindingi665ZincCombined sources1 Publication1
Metal bindingi688ZincCombined sources1 Publication1
Metal bindingi691ZincCombined sources1 Publication1
Metal bindingi696ZincCombined sources1 Publication1
Metal bindingi699ZincCombined sources1 Publication1
Metal bindingi719ZincCombined sources1 Publication1
Metal bindingi722ZincCombined sources1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri606 – 652CXXC-typePROSITE-ProRule annotation1 PublicationAdd BLAST47
Zinc fingeri659 – 725PHD-typePROSITE-ProRule annotation1 PublicationAdd BLAST67

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, Dioxygenase, DNA-binding, Oxidoreductase, Repressor, RNA-binding, rRNA-binding
Biological processTranscription, Transcription regulation, Ubl conjugation pathway
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8NHM5

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-3214842, HDMs demethylate histones

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q8NHM5

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q8NHM5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lysine-specific demethylase 2B (EC:1.14.11.272 Publications)
Alternative name(s):
CXXC-type zinc finger protein 2
F-box and leucine-rich repeat protein 10
F-box protein FBL10
F-box/LRR-repeat protein 10
JmjC domain-containing histone demethylation protein 1B
Jumonji domain-containing EMSY-interactor methyltransferase motif protein
Short name:
Protein JEMMA
Protein-containing CXXC domain 2
[Histone-H3]-lysine-36 demethylase 1B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KDM2B
Synonyms:CXXC2, FBL10, FBXL10, JHDM1B, NDY11 Publication, PCCX2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:13610, KDM2B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609078, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NHM5

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000089094

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1064V → W: Increased interaction with UBB. 1 Publication1
Mutagenesisi1069V → A: Decreased ininteraction with UBB. 1 Publication1
Mutagenesisi1072A → Y: Increased interaction with UBB. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		84678

Open Targets

More...OpenTargetsi		ENSG00000089094

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA164721242

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NHM5, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3779760

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KDM2B

Domain mapping of disease mutations (DMDM)

More...DMDMi		51316032

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001198531 – 1336Lysine-specific demethylase 2BAdd BLAST1336

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei57PhosphoserineCombined sources1
Modified residuei474PhosphoserineCombined sources1
Modified residuei477PhosphoserineCombined sources1
Modified residuei493PhosphothreonineCombined sources1
Modified residuei497PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki857Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki890Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei951PhosphoserineCombined sources1
Modified residuei975PhosphoserineCombined sources1
Modified residuei979PhosphoserineCombined sources1
Modified residuei1018PhosphoserineCombined sources1
Modified residuei1031PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8NHM5

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8NHM5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NHM5

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8NHM5

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NHM5

PeptideAtlas

More...PeptideAtlasi		Q8NHM5

PRoteomics IDEntifications database

More...PRIDEi		Q8NHM5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		61239
73723 [Q8NHM5-1]
73724 [Q8NHM5-2]
73725 [Q8NHM5-3]
73726 [Q8NHM5-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NHM5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NHM5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000089094, Expressed in female gonad and 213 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8NHM5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NHM5, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000089094, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SKP1, forming heterodimers (PubMed:27568929). The heterodimeric KDM2B-SKP1 complex interacts with the PCGF1-BCORL1 heterodimeric complex to form a homotetrameric polycomb repression complex 1 (PRC1.1) (PubMed:27568929). Directly interacts with CUL1. The SKP1-KDM2B complex interacts with UBB (PubMed:30033217).

Curated2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124197, 80 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8NHM5

Protein interaction database and analysis system

More...IntActi		Q8NHM5, 86 interactors

Molecular INTeraction database

More...MINTi		Q8NHM5

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000366271

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q8NHM5

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NHM5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11336
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q8NHM5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8NHM5

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini178 – 346JmjCPROSITE-ProRule annotationAdd BLAST169
Domaini1059 – 1105F-boxAdd BLAST47
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1093 – 1120LRR 1Add BLAST28
Repeati1133 – 1154LRR 2Add BLAST22
Repeati1156 – 1182LRR 3Add BLAST27
Repeati1222 – 1247LRR 4Add BLAST26
Repeati1248 – 1277LRR 5Add BLAST30
Repeati1278 – 1302LRR 6Add BLAST25
Repeati1303 – 1336LRR 7Add BLAST34

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 25DisorderedSequence analysisAdd BLAST25
Regioni410 – 465DisorderedSequence analysisAdd BLAST56
Regioni727 – 843DisorderedSequence analysisAdd BLAST117
Regioni855 – 1034DisorderedSequence analysisAdd BLAST180

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili943 – 971Sequence analysisAdd BLAST29

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi410 – 428Acidic residuesSequence analysisAdd BLAST19
Compositional biasi440 – 454Polar residuesSequence analysisAdd BLAST15
Compositional biasi751 – 814Basic and acidic residuesSequence analysisAdd BLAST64
Compositional biasi815 – 843Polar residuesSequence analysisAdd BLAST29
Compositional biasi868 – 910Basic and acidic residuesSequence analysisAdd BLAST43
Compositional biasi942 – 959Basic and acidic residuesSequence analysisAdd BLAST18
Compositional biasi960 – 974Polar residuesSequence analysisAdd BLAST15
Compositional biasi975 – 1003Basic and acidic residuesSequence analysisAdd BLAST29

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The LRR repeats are required for the interaction with the PCGF1-BCORL1 heterodimeric complex.1 Publication
The JmjC domain mediates demethylation activity (PubMed:17994099). It is also required for repression of ribosomal RNA genes (PubMed:17994099).1 Publication
The CXXC zinc finger mediates binding to DNA containing unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides.1 Publication
The F-box domain mediates interaction with UBB.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the JHDM1 histone demethylase family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri606 – 652CXXC-typePROSITE-ProRule annotation1 PublicationAdd BLAST47
Zinc fingeri659 – 725PHD-typePROSITE-ProRule annotation1 PublicationAdd BLAST67

Keywords - Domaini

Coiled coil, Leucine-rich repeat, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1633, Eukaryota
KOG1947, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154717

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_003540_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NHM5

Identification of Orthologs from Complete Genome Data

More...OMAi		LWKRMNC

Database of Orthologous Groups

More...OrthoDBi		324938at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NHM5

TreeFam database of animal gene trees

More...TreeFami		TF106480

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.40.10, 1 hit
3.80.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001810, F-box_dom
IPR041070, JHD
IPR003347, JmjC_dom
IPR006553, Leu-rich_rpt_Cys-con_subtyp
IPR032675, LRR_dom_sf
IPR002857, Znf_CXXC
IPR011011, Znf_FYVE_PHD
IPR001965, Znf_PHD
IPR019787, Znf_PHD-finger
IPR013083, Znf_RING/FYVE/PHD

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00646, F-box, 1 hit
PF17811, JHD, 1 hit
PF16866, PHD_4, 1 hit
PF02008, zf-CXXC, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00558, JmjC, 1 hit
SM00367, LRR_CC, 6 hits
SM00249, PHD, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57903, SSF57903, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51184, JMJC, 1 hit
PS51058, ZF_CXXC, 1 hit
PS50016, ZF_PHD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NHM5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGPQMGGSA EDHPPRKRHA AEKQKKKTVI YTKCFEFESA TQRPIDRQRY 
        60         70         80         90        100
DENEDLSDVE EIVSVRGFSL EEKLRSQLYQ GDFVHAMEGK DFNYEYVQRE 
       110        120        130        140        150
ALRVPLIFRE KDGLGIKMPD PDFTVRDVKL LVGSRRLVDV MDVNTQKGTE 
       160        170        180        190        200
MSMSQFVRYY ETPEAQRDKL YNVISLEFSH TKLEHLVKRP TVVDLVDWVD 
       210        220        230        240        250
NMWPQHLKEK QTEATNAIAE MKYPKVKKYC LMSVKGCFTD FHIDFGGTSV 
       260        270        280        290        300
WYHVFRGGKI FWLIPPTLHN LALYEEWVLS GKQSDIFLGD RVERCQRIEL 
       310        320        330        340        350
KQGYTFFIPS GWIHAVYTPV DSLVFGGNIL HSFNVPMQLR IYEIEDRTRV 
       360        370        380        390        400
QPKFRYPFYY EMCWYVLERY VYCVTQRSHL TQEYQRESML IDAPRKPSID 
       410        420        430        440        450
GFSSDSWLEM EEEACDQQPQ EEEEKDEEGE GRDRAPKPPT DGSTSPTSTP 
       460        470        480        490        500
SEDQEALGKK PKAPALRFLK RTLSNESEES VKSTTLAVDY PKTPTGSPAT 
       510        520        530        540        550
EVSAKWTHLT EFELKGLKAL VEKLESLPEN KKCVPEGIED PQALLEGVKN 
       560        570        580        590        600
VLKEHADDDP SLAITGVPVV TWPKKTPKNR AVGRPKGKLG PASAVKLAAN 
       610        620        630        640        650
RTTAGARRRR TRCRKCEACL RTECGECHFC KDMKKFGGPG RMKQSCIMRQ 
       660        670        680        690        700
CIAPVLPHTA VCLVCGEAGK EDTVEEEEGK FNLMLMECSI CNEIIHPGCL 
       710        720        730        740        750
KIKESEGVVN DELPNCWECP KCNHAGKTGK QKRGPGFKYA SNLPGSLLKE 
       760        770        780        790        800
QKMNRDNKEG QEPAKRRSEC EEAPRRRSDE HSKKVPPDGL LRRKSDDVHL 
       810        820        830        840        850
RKKRKYEKPQ ELSGRKRASS LQTSPGSSSH LSPRPPLGSS LSPWWRSSLT 
       860        870        880        890        900
YFQQQLKPGK EDKLFRKKRR SWKNAEDRMA LANKPLRRFK QEPEDELPEA 
       910        920        930        940        950
PPKTRESDHS RSSSPTAGPS TEGAEGPEEK KKVKMRRKRR LPNKELSREL 
       960        970        980        990       1000
SKELNHEIQR TENSLANENQ QPIKSEPESE GEEPKRPPGI CERPHRFSKG 
      1010       1020       1030       1040       1050
LNGTPRELRH QLGPSLRSPP RVISRPPPSV SPPKCIQMER HVIRPPPISP 
      1060       1070       1080       1090       1100
PPDSLPLDDG AAHVMHREVW MAVFSYLSHQ DLCVCMRVCR TWNRWCCDKR 
      1110       1120       1130       1140       1150
LWTRIDLNHC KSITPLMLSG IIRRQPVSLD LSWTNISKKQ LSWLINRLPG 
      1160       1170       1180       1190       1200
LRDLVLSGCS WIAVSALCSS SCPLLRTLDV QWVEGLKDAQ MRDLLSPPTD 
      1210       1220       1230       1240       1250
NRPGQMDNRS KLRNIVELRL AGLDITDASL RLIIRHMPLL SKLHLSYCNH 
      1260       1270       1280       1290       1300
VTDQSINLLT AVGTTTRDSL TEINLSDCNK VTDQCLSFFK RCGNICHIDL 
      1310       1320       1330 
RYCKQVTKEG CEQFIAEMSV SVQFGQVEEK LLQKLS
Length:1,336
Mass (Da):152,615
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3A1A17B8EA9EA953
GO
Isoform 2 (identifier: Q8NHM5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     730-730: K → KAYK
     1277-1336: DCNKVTDQCL...VEEKLLQKLS → ASLLGRVFGLQFWGICEPQARKNAGWA

Show »
Length:1,306
Mass (Da):149,034
Checksum:i3329D5375AD25930
GO
Isoform 3 (identifier: Q8NHM5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     856-868: LKPGKEDKLFRKK → Q
     1204-1204: G → GPG

Show »
Length:1,326
Mass (Da):151,328
Checksum:iBCBDAE3F675E017C
GO
Isoform 4 (identifier: Q8NHM5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MAGPQMGGSAEDHPPRKRHAAEKQKKKTVIYTKCFEFESATQ → MEAEKDSGRRL
     818-855: Missing.
     1320-1336: VSVQFGQVEEKLLQKLS → SFQGRSCSTTRLGDE

Show »
Length:1,265
Mass (Da):144,769
Checksum:i69C8C16EFDE3541C
GO
Isoform 5 (identifier: Q8NHM5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-117: Missing.
     654-676: PVLPHTAVCLVCGEAGKEDTVEE → TAIRSLISACPSSNAVETSVILT
     677-1336: Missing.

Show »
Length:559
Mass (Da):63,630
Checksum:i8D324402C781480D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGG3A0A0C4DGG3_HUMAN
Lysine-specific demethylase 2B
KDM2B
704Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBN2F8WBN2_HUMAN
Lysine-specific demethylase 2B
KDM2B
510Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3G4S4R3G4_HUMAN
Lysine-specific demethylase 2B
KDM2B
507Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4A7F5H4A7_HUMAN
Lysine-specific demethylase 2B
KDM2B
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6N6F5H6N6_HUMAN
Lysine-specific demethylase 2B
KDM2B
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4X4F5H4X4_HUMAN
Lysine-specific demethylase 2B
KDM2B
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H0A1F5H0A1_HUMAN
Lysine-specific demethylase 2B
KDM2B
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXC2F5GXC2_HUMAN
Lysine-specific demethylase 2B
KDM2B
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXW2F5GXW2_HUMAN
Lysine-specific demethylase 2B
KDM2B
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7T7F5H7T7_HUMAN
Lysine-specific demethylase 2B
KDM2B
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH08735 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55112 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55301 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC11159 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti864L → F in BAC11159 (Ref. 6) Curated1
Sequence conflicti1226T → R in BAC11159 (Ref. 6) Curated1
Sequence conflicti1295I → T in BAC11159 (Ref. 6) Curated1
Sequence conflicti1334K → R in BAC11159 (Ref. 6) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0573941 – 117Missing in isoform 5. 1 PublicationAdd BLAST117
Alternative sequenceiVSP_0431461 – 42MAGPQ…ESATQ → MEAEKDSGRRL in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_057395654 – 676PVLPH…DTVEE → TAIRSLISACPSSNAVETSV ILT in isoform 5. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_057396677 – 1336Missing in isoform 5. 1 PublicationAdd BLAST660
Alternative sequenceiVSP_011340730K → KAYK in isoform 2. 1 Publication1
Alternative sequenceiVSP_043147818 – 855Missing in isoform 4. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_017475856 – 868LKPGK…LFRKK → Q in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0174761204G → GPG in isoform 3. 1 Publication1
Alternative sequenceiVSP_0113411277 – 1336DCNKV…LQKLS → ASLLGRVFGLQFWGICEPQA RKNAGWA in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0431481320 – 1336VSVQF…LQKLS → SFQGRSCSTTRLGDE in isoform 4. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ459424 mRNA Translation: CAD30700.1
AK027440 mRNA Translation: BAB55112.1 Different initiation.
AK027692 mRNA Translation: BAB55301.1 Different initiation.
AK074718 mRNA Translation: BAC11159.1 Different initiation.
AK127328 mRNA Translation: BAG54483.1
AC048337 Genomic DNA No translation available.
AC073650 Genomic DNA No translation available.
AC145422 Genomic DNA No translation available.
KC877509 Genomic DNA No translation available.
BC008735 mRNA Translation: AAH08735.2 Different initiation.
BC115379 mRNA Translation: AAI15380.1
AL133572 mRNA Translation: CAB63721.2
AB031230 mRNA Translation: BAA97672.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS41849.1 [Q8NHM5-4]
CCDS41850.1 [Q8NHM5-1]

Protein sequence database of the Protein Information Resource

More...PIRi		T43477

NCBI Reference Sequences

More...RefSeqi		NP_001005366.1, NM_001005366.1 [Q8NHM5-4]
NP_115979.3, NM_032590.4 [Q8NHM5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000377069.8; ENSP00000366269.3; ENSG00000089094.20 [Q8NHM5-4]
ENST00000377071.9; ENSP00000366271.3; ENSG00000089094.20
ENST00000611216.4; ENSP00000480847.1; ENSG00000089094.20 [Q8NHM5-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84678

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84678

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000377071.9; ENSP00000366271.3; NM_032590.5; NP_115979.3

UCSC genome browser

More...UCSCi		uc058uhm.1, human [Q8NHM5-1]
uc058uhn.1, human

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ459424 mRNA Translation: CAD30700.1
AK027440 mRNA Translation: BAB55112.1 Different initiation.
AK027692 mRNA Translation: BAB55301.1 Different initiation.
AK074718 mRNA Translation: BAC11159.1 Different initiation.
AK127328 mRNA Translation: BAG54483.1
AC048337 Genomic DNA No translation available.
AC073650 Genomic DNA No translation available.
AC145422 Genomic DNA No translation available.
KC877509 Genomic DNA No translation available.
BC008735 mRNA Translation: AAH08735.2 Different initiation.
BC115379 mRNA Translation: AAI15380.1
AL133572 mRNA Translation: CAB63721.2
AB031230 mRNA Translation: BAA97672.1
CCDSiCCDS41849.1 [Q8NHM5-4]
CCDS41850.1 [Q8NHM5-1]
PIRiT43477
RefSeqiNP_001005366.1, NM_001005366.1 [Q8NHM5-4]
NP_115979.3, NM_032590.4 [Q8NHM5-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4O64X-ray2.13A/B/C607-723[»]
5JH5X-ray2.55A1059-1336[»]
6BVAX-ray2.66E/F1060-1104[»]
AlphaFoldDBiQ8NHM5
SMRiQ8NHM5
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi124197, 80 interactors
CORUMiQ8NHM5
IntActiQ8NHM5, 86 interactors
MINTiQ8NHM5
STRINGi9606.ENSP00000366271

Chemistry databases

BindingDBiQ8NHM5
ChEMBLiCHEMBL3779760

PTM databases

iPTMnetiQ8NHM5
PhosphoSitePlusiQ8NHM5

Genetic variation databases

BioMutaiKDM2B
DMDMi51316032

Proteomic databases

EPDiQ8NHM5
jPOSTiQ8NHM5
MassIVEiQ8NHM5
MaxQBiQ8NHM5
PaxDbiQ8NHM5
PeptideAtlasiQ8NHM5
PRIDEiQ8NHM5
ProteomicsDBi61239
73723 [Q8NHM5-1]
73724 [Q8NHM5-2]
73725 [Q8NHM5-3]
73726 [Q8NHM5-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31579, 319 antibodies from 30 providers

The DNASU plasmid repository

More...DNASUi		84678

Genome annotation databases

EnsembliENST00000377069.8; ENSP00000366269.3; ENSG00000089094.20 [Q8NHM5-4]
ENST00000377071.9; ENSP00000366271.3; ENSG00000089094.20
ENST00000611216.4; ENSP00000480847.1; ENSG00000089094.20 [Q8NHM5-5]
GeneIDi84678
KEGGihsa:84678
MANE-SelectiENST00000377071.9; ENSP00000366271.3; NM_032590.5; NP_115979.3
UCSCiuc058uhm.1, human [Q8NHM5-1]
uc058uhn.1, human

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84678
DisGeNETi84678

GeneCards: human genes, protein and diseases

More...GeneCardsi		KDM2B
HGNCiHGNC:13610, KDM2B
HPAiENSG00000089094, Low tissue specificity
MIMi609078, gene
neXtProtiNX_Q8NHM5
OpenTargetsiENSG00000089094
PharmGKBiPA164721242
VEuPathDBiHostDB:ENSG00000089094

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1633, Eukaryota
KOG1947, Eukaryota
GeneTreeiENSGT00940000154717
HOGENOMiCLU_003540_0_1_1
InParanoidiQ8NHM5
OMAiLWKRMNC
OrthoDBi324938at2759
PhylomeDBiQ8NHM5
TreeFamiTF106480

Enzyme and pathway databases

PathwayCommonsiQ8NHM5
ReactomeiR-HSA-3214842, HDMs demethylate histones
SignaLinkiQ8NHM5
SIGNORiQ8NHM5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84678, 26 hits in 1134 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		KDM2B, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84678
PharosiQ8NHM5, Tchem

Protein Ontology

More...PROi		PR:Q8NHM5
RNActiQ8NHM5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000089094, Expressed in female gonad and 213 other tissues
ExpressionAtlasiQ8NHM5, baseline and differential
GenevisibleiQ8NHM5, HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR001810, F-box_dom
IPR041070, JHD
IPR003347, JmjC_dom
IPR006553, Leu-rich_rpt_Cys-con_subtyp
IPR032675, LRR_dom_sf
IPR002857, Znf_CXXC
IPR011011, Znf_FYVE_PHD
IPR001965, Znf_PHD
IPR019787, Znf_PHD-finger
IPR013083, Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00646, F-box, 1 hit
PF17811, JHD, 1 hit
PF16866, PHD_4, 1 hit
PF02008, zf-CXXC, 1 hit
SMARTiView protein in SMART
SM00558, JmjC, 1 hit
SM00367, LRR_CC, 6 hits
SM00249, PHD, 1 hit
SUPFAMiSSF57903, SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS51184, JMJC, 1 hit
PS51058, ZF_CXXC, 1 hit
PS50016, ZF_PHD_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKDM2B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NHM5
Secondary accession number(s): A8MRS1
, Q1RLM7, Q8NCI2, Q96HC7, Q96SL0, Q96T03, Q9NS96, Q9UF75
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: October 1, 2002
Last modified: May 25, 2022
This is version 183 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again